KEGG   Granulicella mallensis: AciX8_1246Help
Entry
AciX8_1246        CDS       T01664                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gma  Granulicella mallensis
Pathway
gma00010  Glycolysis / Gluconeogenesis
gma00620  Pyruvate metabolism
gma00640  Propanoate metabolism
gma00680  Methane metabolism
gma01100  Metabolic pathways
gma01110  Biosynthesis of secondary metabolites
gma01120  Microbial metabolism in diverse environments
gma01130  Biosynthesis of antibiotics
gma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX8_1246
   00620 Pyruvate metabolism
    AciX8_1246
   00640 Propanoate metabolism
    AciX8_1246
  Energy metabolism
   00680 Methane metabolism
    AciX8_1246
Enzymes [BR:gma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AciX8_1246
Lipid biosynthesis proteins [BR:gma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AciX8_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEU35590
JGI: AciX8_1246
UniProt: G8NY02
Position
1463595..1465577
Genome map
AA seq 660 aa AA seqDB search
MSVESTPVGSTLNENFESLMREDRVFPPPAAFAARARIGSEAEYERMYKRSIEAPEEFWA
EAAAELEWFTPWTKVLEGSGPHAKWFTGGKLNLSHNCVDRHAKAARKDKVALLWEGEPGE
VRRLTFAELHVEVQKFANVLKSLGVKKGDRVAVYMGMSPELAIALLACARIGAVHSVIFG
GFAAHAISDRVNDSDCQVIVTQDLSYRRGSEVKLKKIVDEALEKCPGVRKVIVYQRAPSA
TVAMKEGRDFWWHEAMAAAAADCSAEPMDAEDPLYILYTSGTTGKPKGLVHTTGGYSVQT
YLTSKYIFDLQDEDVYWCTADIGWVTGHSYVVYGPLQNGATVMMYEGAPNWPENDRFWKI
VDDHKVTVFYTAPTAIRAFIKWGNDWVHKHSLASLRLLGTVGEPINPEAWMWYHREIGKE
RCPIVDTWWQTETGAILIAPIPGAVATKPGSATRPFFGVVPEIVTKEGDPVPAGQGGLLV
IKKPWPSLARTIWGDAERYEQAYFSEIPGIYFTGDGARRDADGYYWLMGRVDDVINVSGH
RLGTMEIESALVAHSKVAEAAVVGRPCEMKGQAIAAFVTLEEGYEPSEELKQELRQWVAK
EIGGLARPDDMRFTQMLPKTRSGKIMRRLLRELATTGEVKGDTTTLEDFGVLAKLKENEE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgaaagcacgcctgtgggaagcacgctaaacgaaaactttgagtctcttatg
cgggaagaccgggtctttccgccccctgcggcctttgccgcccgggcacgtatcggcagc
gaagccgagtatgagcggatgtacaagcgcagtatcgaagctccggaggagttctgggcc
gaggctgctgccgaactggagtggtttactccgtggacgaaggtgctcgaaggcagcggg
ccgcatgcgaagtggtttaccggcggcaagctgaatctctcgcacaactgcgtcgatcgc
catgccaaggcagcacgcaaggataaggtcgccctgctgtgggagggtgagccgggagaa
gtgcgcaggctgacctttgccgaactgcatgttgaagtccagaagtttgccaatgtgctg
aagtcacttggcgtgaagaagggcgatcgcgttgcggtgtacatgggcatgagcccggag
ctggcgattgcgctgctggcctgcgcgcgcatcggtgcggtgcattcggtgatcttcgga
ggattcgcagcgcatgcgatctcggaccgggtgaacgactcggattgccaggtgatcgtg
acgcaggacctcagctatcgtcgcggctccgaagtgaagctgaagaagatcgtcgacgag
gcgctggagaagtgccccggcgtacggaaggtgatcgtgtatcagcgcgctccttcggcg
acagtggcgatgaaggaaggtcgcgatttctggtggcacgaggcaatggccgctgccgct
gcggattgctcggctgagcccatggatgctgaagatccgttgtacatcctgtacaccagc
ggaacgaccggcaagcccaaagggttggtgcatacgacaggcggctactcggtacagacg
tacctgacgagcaagtacatcttcgatctccaggacgaggacgtgtactggtgcactgcc
gacattggctgggtcacggggcacagctacgtggtctatggtccgctgcagaacggcgcg
acggtgatgatgtatgaaggcgcgccgaactggccggagaatgataggttctggaagatc
gtcgacgatcacaaggtcacggttttctacaccgcgccaacggcgatccgtgcctttatc
aagtggggtaacgactgggtgcacaagcactcgctggccagtctgcgactgctgggaacg
gtcggtgaaccgatcaatcccgaggcgtggatgtggtatcaccgcgagattggcaaggag
cgctgcccgatcgtcgatacctggtggcagacggagacgggtgcgattctgattgcgccg
atccccggcgctgtcgcgacgaagcccggctcggctacgaggccgttcttcggcgttgtg
ccggagatcgtgaccaaggaaggcgatccggtaccggcagggcagggtggactgctggtc
atcaagaagccgtggccatcgcttgcacgaacgatctggggcgacgcggagcggtatgag
caggcgtacttctcagagatcccggggatctactttacgggcgacggcgcacgccgcgat
gccgacggttactactggctgatgggccgtgtggacgacgtgatcaacgtcagcgggcac
cgtttgggcacaatggagatcgagtccgcgctggtggcacactcgaaggtggctgaggct
gctgtggttggacgtccttgcgagatgaaggggcaggcaattgccgcgtttgtgacgctt
gaagagggctacgagccgagcgaagaactcaagcaggagctgcggcagtgggtcgcgaag
gagatcggcgggctcgcccgtccggacgacatgcgctttacgcagatgctgcctaagaca
cgttcaggcaagatcatgcggcggttgctgcgcgagcttgcaaccaccggcgaagtgaag
ggcgatacgactacgctggaggactttggcgtgctggcaaagctgaaggagaacgaggag
taa

DBGET integrated database retrieval system