KEGG   Granulicella mallensis: AciX8_1346Help
Entry
AciX8_1346        CDS       T01664                                 

Definition
squalene/oxidosqualene cyclase
Orthology
K06045  
squalene-hopene/tetraprenyl-beta-curcumene cyclase [EC:5.4.99.17 4.2.1.129]
Organism
gma  Granulicella mallensis
Pathway
Sesquiterpenoid and triterpenoid biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    AciX8_1346
Enzymes [BR:gma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.129  squalene---hopanol cyclase
     AciX8_1346
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.17  squalene---hopene cyclase
     AciX8_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1565426..1567456
Genome map
AA seq 676 aa AA seqDB search
MSTTPINPSNPGGTAPKQPRFGRLDMAMDLVIGGINRSVEWLMGEQEEPGYWCGELEADS
MLEADYIFMHTLLGSGDRGKMERCINEILRHQNADGGWSLYPGGPSNVHYGVKCYLALKL
MGWSADDPVLVRARENVLSLGGVVECNTFTKIYLCALGQYDYDAVPAVPPEMLLFPNWFY
FNIYEISSWSRGILVPLSVIYSTKPFKKLPPEQGIDELFVGGRANADLHLRWNKKKFFSW
SNFFLMLDRMMHWAERIHIRPLRKIALKKAEKWMLDRFEMSDGLGAIYPAMMNSIIALRY
LGYSEDDPQFIRAMDEFEKLGIEEPEVPDANPARFRMQPCMSPVWDTAYAVFALGEAGVP
KDDPRLLKAADWMLSKEVRHKGDWAVKVKNVEPGGWYFEFNNEFYPDVDDSAQVLLALNC
VQNPRERYQYEVSQRALNWIFAMQCKNGGWASFDKDNTKQIFESIPFADHNAMIDPPTVD
ITGRILEMLSGYGFTRSDKRVEKAVQFILKGQEPDGSWFGRWGVNYLYGTFLVLRGLEAI
GYSYLEPAVQQAAEWIRMVQNTDGGWGETCGTYDDPNQRGVGPSTPSQTAWAILGLLAAN
DTRSDSVAKGIRWLIERQHEDGSWDELMPGRNGESYYTGTGFPRVFYLGYHLYKQYFPLL
ALTTYRKALEREQAEA
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaacaccgatcaatccgagtaatccggggggtacggctccaaagcagccacgg
ttcggccggctcgacatggccatggaccttgtcattggtggcatcaaccggtcggttgaa
tggctgatgggcgagcaggaagagccaggctactggtgcggagagcttgaagccgactcg
atgctcgaggcggactatatcttcatgcatacgctgctggggtctggcgaccgcggcaag
atggagcggtgcatcaacgagattctgcgccaccagaacgccgatggcggatggagcctg
tatcccggcggtccgtcgaatgtgcactacggcgtgaagtgctatctcgcgctgaagctg
atgggctggagcgccgacgatccggtgttggtgcgggcgcgtgagaacgtgctttcgctg
ggtggcgtggtcgagtgcaataccttcaccaagatctatctctgcgcgctgggtcagtac
gactatgacgcggttccggctgttccgccggagatgctgctgtttccgaactggttctac
ttcaatatctacgagatcagctcgtggtcgcgcggcattctggtgccgttgtcggtcatc
tactcgaccaagccgttcaagaagctgccgcctgagcagggtatcgacgagctgttcgtc
ggcggccgcgccaatgccgacctgcatctgcgctggaacaagaagaagttcttctcctgg
agtaacttcttcctgatgctcgatcgcatgatgcactgggctgagcgtatccacattcgc
ccgctgcgcaagatcgcgctgaagaaggctgagaagtggatgctggaccggttcgagatg
tcggatgggttgggcgctatctatcccgcaatgatgaactccatcattgcgctacgctac
ctgggctactcagaagacgatccgcagttcatccgcgcgatggacgagttcgagaagctg
ggcattgaagagcccgaggttccggatgcaaacccggcacgtttccgcatgcagccttgc
atgtcacccgtatgggacaccgcatatgcggtcttcgcgttgggcgaggcgggtgttccc
aaggacgatccccggctgctcaaggctgccgactggatgctgtccaaagaagtgcggcac
aagggcgactgggcggtcaaggtcaagaacgtcgagcccggcggttggtacttcgagttc
aataacgagttttatcccgacgtcgacgattcggcgcaggtgctgctggccctgaactgc
gttcagaaccctcgcgagcgctaccagtacgaggtctcgcagcgggcgttgaactggatc
ttcgcgatgcaatgcaagaacggcggctgggcttcgttcgacaaggacaacacgaagcag
atcttcgagtcgatcccgtttgccgaccataacgcgatgatcgatccgccgacggtcgac
atcaccgggcgcatcctggagatgctctccggctacggcttcacgcgcagtgataagcgc
gtggagaaggcggtccagttcatcctcaaggggcaggagccggatggctcgtggtttggc
cgctggggcgtcaactatctctacggaacattcctggtcctgcgcgggctggaggcgatc
gggtactcgtacctggagccggcagtgcagcaggcggcggagtggatccgcatggtgcag
aacaccgacggtggatggggcgagacctgcggcacctatgacgatccgaaccagcgtggc
gttgggccttctacgccctcgcagacggcctgggcgatcctcggattgctggctgcgaac
gatacccgttcggactcggtagccaagggaattcgctggttgatcgagcgtcagcatgag
gacggctcgtgggatgagctgatgccgggccgcaatggcgagagctattacaccggaacg
ggcttccctcgcgtcttctacctggggtatcacctgtacaagcagtacttcccgctgttg
gcgctgacgacgtatcgcaaggcgctcgagcgtgaacaagccgaagcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system