KEGG   Granulicella mallensis: AciX8_1355Help
Entry
AciX8_1355        CDS       T01664                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
gma  Granulicella mallensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AciX8_1355
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AciX8_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1575168..1575941
Genome map
AA seq 257 aa AA seqDB search
MRHSRGIIALAAAVAVIGGLGLVHPFGNPRVEPGKGLDTLLVHASMPADAKKILISKCAD
CHSNETRWPVYALLAPGSWLIEWDIVEARKKLNLSSWDQMAADAQEQMIGEIIHEAKAGE
MPPSQYRLLHWKSQLTTQDVATLSSMKTSEATQASTSSSGDAARGKMVFEKRCMGCHTME
TDREGPRLAGVFGRKAGSVAGFNYSEGLKKSGITWDEASLEKWLTDPDMMVPDNNMSIGV
PKAQERSDLIAYFKQFK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgagacattcacgtggaatcatcgctctggccgcagccgtggctgtcatagggggattg
gggcttgttcatccgtttggtaacccacgtgtcgagcctggaaaggggctcgacacgctg
ttggtgcacgcaagtatgcctgctgacgcgaagaaaatcctcatcagcaaatgtgctgac
tgtcactcgaatgaaacccggtggccggtgtatgcactcctggcacccggatcgtggctg
atcgagtgggatatcgtagaggcgcgcaagaagctgaatctctcatcctgggatcagatg
gctgccgatgcacaagagcagatgatcggagagatcattcacgaagcgaaggctggtgag
atgccgccgtcgcagtaccgtcttcttcattggaaatctcaactgacaactcaggatgtg
gcaacactctcgagtatgaaaacgagcgaagcaacgcaagcgagtacaagcagctctggc
gatgccgcgcgcggaaagatggtgtttgaaaagcggtgcatgggctgccacacgatggag
acagatcgggaaggaccgcggctggccggtgtatttggaagaaaggccggaagcgtggcg
ggattcaactactccgaggggctaaaaaaatctggcattacctgggatgaagcttcgttg
gagaagtggctcaccgacccggacatgatggtgccggacaacaatatgagcatcggtgtt
ccgaaggctcaggagcggtcggatttgattgcctatttcaagcaatttaaatag

DBGET integrated database retrieval system