KEGG   Granulicella mallensis: AciX8_1420Help
Entry
AciX8_1420        CDS       T01664                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gma  Granulicella mallensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AciX8_1420
DNA repair and recombination proteins [BR:gma03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AciX8_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1651850..1652452)
Genome map
AA seq 200 aa AA seqDB search
MATRFAEPMARLIDELRKLPGVGTKTAQRYAFHILRSSDSDATTLADSIRALKQHLHLCS
ICNNITDVDPCAYCTSPARNTHLICVVEEPTNINAIEKTRTYTGVYHVLHGTLSPVNGVG
PEQLRLRNLWPRLAEAEELILATSPTVEGEATARYLLDDIRKTHPTLHISRIATGVPAGS
DIEYADEVTMTRALEGRRDL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctacccgtttcgccgagcccatggcccggctcatcgacgaactccgcaagctgccc
ggcgtcggcaccaagaccgcgcagcgctacgccttccacatcctgcgttcgtccgactcc
gacgccaccacgctcgccgactccatccgcgccctcaagcagcatctgcacctctgctcc
atctgcaacaacatcaccgacgtcgacccctgcgcctactgcaccagccccgcgcgcaac
acgcacctgatctgcgtcgtcgaagagcccaccaacatcaacgccatcgaaaagacccgc
acctacaccggcgtctaccatgtgctccacggcacactctcgccggtcaacggcgtcggc
cccgaacagcttcgcctgcgcaacctctggccgcgcctggccgaagcggaagagttgatc
ctcgccaccagcccaacggtcgaaggcgaagccacggcacgctatctgctcgacgacatc
cgcaagacccaccccaccctgcatatcagccgcatcgccaccggcgtccccgccggcagc
gacattgagtacgccgatgaagtcacgatgacccgcgccctcgaaggccgacgcgaccta
taa

DBGET integrated database retrieval system