KEGG   Granulicella mallensis: AciX8_1497Help
Entry
AciX8_1497        CDS       T01664                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gma  Granulicella mallensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AciX8_1497
Enzymes [BR:gma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AciX8_1497
Peptidases [BR:gma01002]
 Cysteine Peptidases
  Family C44
   AciX8_1497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1747068..1749065
Genome map
AA seq 665 aa AA seqDB search
MCGISGFLDLNHATPAPELRRIAMRMADTLRHRGPNDAGVWADEGAGIALSMRRLAILDL
SPAGHQPMESASGRYMLVFNGEIYNYQDLRNELSPAYSFRGSSDTEVMLAAFEQWGIESS
VPRLNGMFAFALWDRQERSLTLGRDRFGEKPLYYARMGSHFIFGSELKALRAHPRFAGEV
DVDAAALFLRYSCVPAPYSIYKHTSKLPAATLLKVSADDFASTPQPYWSLRSVIDEAVSH
PFDGSEHEAVEQLDSILRDAVRIRMHSDVPLGAFLSGGIDSSIIVSLMQAQSRTRVKTFT
IGSHDKEFDEAQDAAKIAAHLGTEHTELYITAEKAISVIPLLPRFYDEPFADSSQIPTLL
VSQLAKEHVTVSLSGDGGDELFGGYTRHIWGDTLDRLHRVPLFLRRFGAAGIKTIPPGGW
DLLSQMSWPVTPARWRQRIPGHKLHKLASLLESRSVHSLYEKLSSHWLDAAKVLPGASFI
PFSEDNPSSLRHSAENLMYLDAIGYLPDDILVKLDRATMAVSLEGRVPFLDHRVAEFAWR
LPLSMKIRQRQGKWILRQVLYRYVPREMVDRPKSGFGIPLAAWLRGPLRDWAESLLDERR
LRQEGFFNPAPILKMWREHLSGKQNWEYHLWDVLMFQGWLEESRRTPAGLSSDSEDIANA
TVERA
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcagcggctttctcgatctcaaccatgcaaccccggcccctgagctgcgg
cgcatcgccatgcgcatggccgataccctgcgccaccgtgggcccaacgatgcaggcgta
tgggctgatgagggtgctggtattgcactcagcatgagacggctggcgatcctcgatctt
tcccctgccgggcatcaacccatggaatcagccagcggccgctacatgctcgtcttcaac
ggcgagatctataactatcaggacctgcgcaacgagctttcccctgcgtattccttccgg
ggaagttccgataccgaggtgatgctcgcggccttcgagcaatggggtatcgaatcgtcg
gtgcccagattgaacgggatgttcgcctttgccttgtgggatcgccaggaaagaagcctg
actctcggacgcgatcgttttggagaaaagccgctctactatgccaggatgggaagccat
tttatctttggttcggagctgaaggctctgcgtgctcatcctcgatttgcaggtgaagtg
gatgtggatgcagcagcactctttctgcgctatagctgtgtcccggcgccttattccatc
tataagcacaccagcaagctgcccgccgcgacgctgttgaaagtctcggccgatgatttc
gcatcaacaccgcagccctattggtcattgcgtagcgtcattgacgaagccgtatcccat
cccttcgacggcagcgagcacgaagcggtggaacaactggactccatcctgcgcgatgct
gttcgtattcgcatgcattcggatgttccgcttggggcgtttctttcgggaggaatcgac
tcctccatcatcgtgtcgttgatgcaggcccagagccggacccgggtgaagacattcacg
atagggagccatgacaaggagttcgacgaagcccaggatgccgcgaagatcgccgctcat
ctgggaacggaacataccgagctctatataaccgctgagaaggcgatatcggtgattccg
ctgcttccgaggttctacgacgagccgttcgcggactcctcgcaaattccaaccctgctg
gtttcgcaactcgcgaaggaacacgtaactgtgagtctctccggcgatggcggcgacgaa
ctctttggtgggtacacccgccatatatggggagacacgctcgaccgccttcatcgcgtg
ccgctttttctgcgcagattcggagcagccggtatcaagactatccctccgggcggctgg
gatcttctctctcaaatgagctggccggtaactccggcacgatggcggcagcgcataccg
ggacacaagctgcacaagctggcctccctgttggaaagccgtagtgttcactcactctac
gaaaaactgtcctctcactggctggatgctgcgaaggttctgccgggagcttccttcatc
ccgttctccgaagacaatccatctagccttcgtcattcggctgagaacctcatgtatctg
gacgccatcggttatctgccggacgacatcctggttaaactcgaccgggcaaccatggcc
gtcagccttgagggacgggttccattcctggatcatcgggtagcggagtttgcctggaga
ttgccgctgtccatgaagattcgccagcggcaagggaaatggattcttcgccaggtgctt
taccgctacgtgccgcgtgagatggtcgaccgccccaagtcgggctttggaatcccgctg
gcagcctggctgcgcggccctctgcgcgactgggccgaatcgcttctggacgagaggcgc
ctgcggcaggaaggattcttcaacccggcgccgatcctgaagatgtggcgagaacatctc
tcgggaaagcaaaattgggaataccatctgtgggatgtgctgatgttccagggatggctc
gaagaaagccgccgcacccctgccggtctatcttccgatagcgaagacattgccaacgca
acggtggaaagggcatga

DBGET integrated database retrieval system