KEGG   Granulicella mallensis: AciX8_1580Help
Entry
AciX8_1580        CDS       T01664                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gma  Granulicella mallensis
Pathway
gma00500  Starch and sucrose metabolism
gma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciX8_1580
Enzymes [BR:gma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AciX8_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: AEU35920
JGI: AciX8_1580
UniProt: G8NNP5
Position
complement(1839929..1841509)
Genome map
AA seq 526 aa AA seqDB search
MAAERISGVLLHVTSLPSYGGVGDFGPAAYNFVDFLAAAKQRMWQVLPLSPTGYGSSPYS
ALSAFAGNPLFISLERLAEAGWIGWDRIQGLPGAEGPCDFGAAFDLKHPLIEEAAANFLD
RAGDEDRARFQHFAQDNTSWLTDYAMFNLLRRRFGYASWNEWPSEYALRIPEAMTALLTD
SGRDLAIEQVVQFFFNEQWVALRAYCAERKISILGDVAIFVSYDSADVWTHPEIFELDDQ
RKPIRVSGVPPDYFSKTGQRWGNPLYKWKLLEEHGFDWWVARIRRALALYDNVRLDHFRG
FEAYWSVAAEEETAINGQWVKAPGRPLFQRLKEIFGELPFIAEDLGLITPEVDELREYFG
LPGMRILQFGFADRGGHLYLPHRYVPNTVVYTGTHDNNTTLGWWRDDASPVERENVQVYL
HRIDHDGDIVWAMIKAAAGSVATTCIFPLQDVLHLGSEARMNVPAAPNGNWTWRYAPNAL
HPDFATQLAAIMEMTDRDGYQKPLEGEGAGGPTDEAHLRVDEGSQS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggagcgcatctcaggagttttgttacacgtaacgtctctgccctcgtatggc
ggagtgggcgacttcggcccggcagcctacaacttcgttgacttcctggcggcggccaag
caacgcatgtggcaggtgcttccactcagcccgacgggctatggcagctctccctactct
gctctgtcggcgtttgcgggaaaccctctgtttatcagcctggaacggctggcggaggca
ggatggattggctgggaccgcatccaggggttgcccggcgcggaagggccctgcgacttc
ggcgcggccttcgatctcaaacacccactgattgaagaggcagcggcgaactttctcgac
cgcgccggagacgaagaccgcgcacgcttccagcacttcgcgcaggacaacacctcctgg
ctcaccgactatgcgatgttcaacctgctgcggcggcgcttcggttatgcgagctggaac
gagtggccctccgagtatgccctgcgcatccccgaggccatgaccgcgctgctgacggac
agtggccgcgacttggcgatcgagcaggtggtgcagttcttcttcaacgagcagtgggtt
gcgttgcgcgcctactgtgcggagcgcaagatcagcatcctgggcgatgtcgcgatcttc
gtcagctacgatagtgcggatgtgtggacgcaccctgagatcttcgaactcgacgatcag
cgcaagccgattcgagtctcaggcgtgccgcccgactacttctcgaagacaggccagcgc
tggggcaatcctctgtacaagtggaagctgctggaagaacatgggttcgactggtgggtg
gcgcgcattcgtcgtgcgctggcactctacgacaatgttcgcctggaccacttccgcggc
tttgaggcctactggtccgtagccgccgaggaagagaccgccatcaatggccagtgggtc
aaagctccgggacggccgctgtttcagcggctcaaggagatcttcggagagctcccgttt
atcgcggaggaccttggcctcatcacgcctgaggtcgatgagttgcgcgagtacttcggt
ctgcccggcatgcgtattttgcagttcggcttcgcggaccggggcgggcatctctacctg
ccgcatcgttacgtgcccaatacggtggtctacacgggcacgcacgacaacaacacgacg
ctcggttggtggcgcgatgatgcctcgccggtggagcgcgagaatgtgcaggtttacctg
caccgtatcgaccacgacggcgatatcgtgtgggcgatgatcaaggcagcagccggctcc
gtggcgacgacctgcatcttccccttgcaggatgtcctgcatcttggcagcgaagcccgc
atgaacgtgcctgccgcgcccaacggcaactggacatggcgctatgcgcctaatgcgctg
catccggacttcgcgacccagctggctgcgatcatggagatgaccgaccgcgacggctat
caaaagccgcttgagggagagggtgcaggcggccccaccgacgaagcccatctgcgcgtg
gatgagggatcgcaaagctaa

DBGET integrated database retrieval system