KEGG   Granulicella mallensis: AciX8_2185Help
Entry
AciX8_2185        CDS       T01664                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gma  Granulicella mallensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciX8_2185
Enzymes [BR:gma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AciX8_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2597009..2598133)
Genome map
AA seq 374 aa AA seqDB search
MTIQIIAALLSLGLSSIPQSSWPLWTSYANHFIQEDGRVVDPDRDDLTTSEGQSYAMFFA
LVANDRARFDHLFLWTVNNLAGGTIETTLPAWSWGKKTDGSWGIKDTNSASDSDLWIAYD
LIQAGRLWKSPVYANTGMGLLKLIAEKEVSHVHSFPILLPAQTGFEHDGMTVMNPSYMPL
FLLQSAATVQPEGPWGAMAASLPSLVRGGTAAGFAPDWIKIEPDGTMSSTPPLDLSTEQA
TGSYDAIRVYLWAGLTSSNTHGRDDLLKALSGMTSYMRTHPLPPEFVIEDKPEVRGDGPI
SFSAALIPFLQESRAPEAVAQQKKRLKDALSTGTGLYGQPPRYYDQNLAMFALGYTEHRF
HIQSNGELEVPWQR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccagatcatcgcggctctgctttcgctcggattgagttcgatcccgcaatct
tcatggcctttatggaccagctacgccaaccacttcatacaagaggatggccgcgttgta
gatccagatcgtgacgacctgacaacctccgaagggcaaagctatgccatgttcttcgcg
ctcgtcgctaatgatcgggcacgtttcgaccatttatttctctggaccgtgaataacctg
gcaggcggcacgatcgaaacaactcttccggcctggagttggggtaaaaaaacagacggg
agttggggaataaaagatactaactctgcaagcgattcggacctatggatagcctacgat
ctcattcaggcagggaggctgtggaagtctccggtctatgcaaataccgggatggggcta
ctcaagttaatcgcagaaaaagaagtgtcccatgtgcactctttccctattcttctgccg
gcgcaaacgggatttgagcatgatggaatgaccgtgatgaatcccagttacatgccactg
tttctcttgcaatcggctgccacggtacagcctgaaggcccatggggagcaatggcggca
tctctgccctctcttgttcgcggaggaactgctgcaggttttgctccagattggataaag
atagagcctgatggaacaatgagctctacacctccccttgatctcagtacagaacaggcg
acaggaagttatgatgccatccgtgtctacctctgggccggtcttacgtcttcgaacact
cacggccgtgatgatctcctgaaggcgctttcaggaatgacctcctacatgaggacacac
cctttgcctccggagttcgtcatcgaagataagccagaggtccggggggatggcccaatt
tccttctctgcggcgcttatcccttttctacaggaatctcgggcgcctgaagctgtcgca
cagcagaagaaacgcctgaaggatgcattgtcaacaggcacaggtttatatgggcaacct
ccccggtattacgaccagaatttagcaatgttcgcacttggctatacggagcatcgcttc
catatccagagcaatggcgagttggaggttccatggcaaagatga

DBGET integrated database retrieval system