KEGG   Granulicella mallensis: AciX8_2245Help
Entry
AciX8_2245        CDS       T01664                                 

Definition
glucosylceramidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
gma  Granulicella mallensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gma00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:gma00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2687787..2690222
Genome map
AA seq 811 aa AA seqDB search
MKRTSKWISTRGLAFPILAFTLCLSMASTAWGGDGIPKAAWKRALGLPLENPGVTRAAGD
IDDGYWQGVPVGGFGAGTFSRSYRGDFARWHIKAGVHKYEPVYANQFAMFQQSEGDAHGT
SQALMNGHPSNGELSSWQWDYPVGAGDYYGLFPKAWFDYKWDKFPAHVTLEQFSPVLPNN
YRESSYPVAVYRWHAENPTNKTVVVSVLLSWTNMSGWFRTYTRDFKGAPNQGNHNEYVSE
KVGDAGTMKGIVFDRNRAGTAPNDWDGQFAIAAMESPGVEVSYQTTYQASGDGKAVWSAF
SKDGRLANDGKSWVSDKEKLAGAIALRFTLRPGEKKVVPMVVSWDFSLIQFGEGRKWDRR
YTDFYGTSGQNAWKIARDGLLHATEWSDEIDKWQAPYITDESKPLWYRGMLFNELYALTD
GGTFWGRQAGSDAKATPTFALLECFDYAYYGTLDVRFYASLPLLKFWPDIDKQVLREFAD
TVPKEWPEQGLWVWKTQQVGEPITHKRKKIGAVPHDLGVPEGDPFVAVNEPGWQDTNDWK
DLNSKFVLMVYRDYVLTGRKDTAFLRETWPAVKAAIEYLRQFDHGGGVPENSGYPDQTYD
DWVVRGVSAYSGGLWLAALRAGEETARVVGDTKTTAEYHALFLKGQKTYISQLWNGEYFR
YDTSSESKDDIQADQLAGQWYANLTGLGEIVPHTMQVSAAKKIFDVNVMKFGHGEMGAAN
GMTADGAILTNAEAKEVWVGTTLGYAGLLMQEGMNDEAWKTTRGLYHVIYEDKGYWFRTP
EAWDITGNFRAGMYMRPTAIWALEMTSPTAK
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaacatcgaagtggatatcgacccgtggcctggcattccctatcctggcgttt
acgctctgcctttcaatggcttccactgcatggggtggagacggcattcccaaggctgcc
tggaagcgcgcactgggattgcccttggaaaaccctggcgtgacgcgcgcggctggcgat
atcgatgatggctattggcagggtgtccccgtcggtggctttggagcagggaccttttcc
cgcagctatcgaggcgacttcgctcgctggcatatcaaggccggagtgcataagtatgag
ccggtgtatgccaaccagttcgccatgttccagcagtccgagggggacgctcacggcacg
tcgcaggcgttgatgaacggccatccctccaatggggaactatccagttggcaatgggat
tatccagtcggggcgggggattattatgggctcttcccgaaggcgtggtttgactataag
tgggacaagttccccgcgcatgtcacgctggagcagttttcgccggtgcttcccaacaac
tatcgtgaatccagctatccggttgccgtataccgctggcatgcggagaatcccaccaat
aagacagtcgtggtctcggtgctgctttcctggacaaatatgtcaggttggttccggacc
tatacgcgcgacttcaaaggggcgcctaatcaaggcaaccacaatgagtatgtgagcgag
aaggtcggtgatgcgggaacgatgaaaggtatcgtcttcgatagaaaccgcgctgggacg
gctcccaatgattgggatgggcagttcgccatcgcggcgatggaatcgcccggtgtggaa
gtctcctaccagactacctaccaggcatccggagatggcaaagctgtctggtcggcgttt
tccaaagatggcagactcgctaacgatgggaagtcgtgggtgagcgataaggagaagctg
gcaggtgcgattgccctgcgcttcactctgcggccaggagagaagaaagtggttccgatg
gtcgtctcctgggacttttccttgattcagtttggagaaggcagaaagtgggatcgccgc
tatacggatttctacggaacctccggccagaatgcctggaagattgctcgtgatgggcta
ctccatgccaccgagtggagcgatgagatagacaagtggcaggccccctacattactgac
gaaagcaagccgctgtggtatcgcgggatgcttttcaatgagctttatgcgctaaccgac
ggaggaacgttctgggggcgccaggccggctcagatgcaaaggccacgccgaccttcgcg
ctgctcgagtgtttcgattacgcctactacggcacgctcgatgtccgtttctatgcctcc
cttccactgttgaagttctggccggacatcgacaagcaggtgctccgagagtttgccgat
accgtgcctaaggagtggccggaacaggggctttgggtatggaagacgcagcaggtggga
gagcctattacccacaagcgtaagaagatcggtgcggtaccgcatgacctaggtgtgccg
gaaggcgatccctttgtcgccgtgaacgagcccggctggcaggacaccaacgattggaaa
gacctcaacagcaaattcgtgctgatggtctatcgagactatgttcttaccggtcgcaag
gacaccgcatttctgcgagaaacctggcccgcggtcaaagccgcgatcgaatatcttcgc
cagttcgatcatggcggcggtgtcccggagaacagcggctatcctgaccagacctatgac
gactgggtggttcgcggggtaagtgcttattctggcggtctatggctggccgctctacgc
gctggagaagaaaccgcgcgtgtggtcggcgatacgaaaacaactgcggagtatcacgca
ctcttcctgaaagggcagaagacctatatctcccagctatggaatggcgaatactttcgc
tatgacaccagcagcgaatccaaagatgacatccaggctgaccaacttgccgggcaatgg
tatgccaacctcaccggtctcggcgagatcgtaccgcatacgatgcaggtctcggcggcg
aagaagatcttcgacgtcaacgtgatgaagtttggccacggcgagatgggtgcggccaat
ggcatgacagcggacggcgccatcctcaccaacgcagaggccaaagaggtatgggtagga
actacactcggctatgctggcctgctgatgcaggagggaatgaacgatgaagcttggaag
accacccgggggctctatcacgtgatctacgaagacaaaggctactggttccggacaccc
gaggcctgggacatcaccggtaacttccgggcaggaatgtatatgcggccgacagccatc
tgggcgctggaaatgacctctcccacggcaaaatag

DBGET integrated database retrieval system