KEGG   Granulicella mallensis: AciX8_2253Help
Entry
AciX8_2253        CDS       T01664                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gma  Granulicella mallensis
Pathway
gma00010  Glycolysis / Gluconeogenesis
gma00052  Galactose metabolism
gma00500  Starch and sucrose metabolism
gma00520  Amino sugar and nucleotide sugar metabolism
gma00521  Streptomycin biosynthesis
gma01100  Metabolic pathways
gma01110  Biosynthesis of secondary metabolites
gma01120  Microbial metabolism in diverse environments
gma01130  Biosynthesis of antibiotics
gma01200  Carbon metabolism
Module
gma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciX8_2253
   00052 Galactose metabolism
    AciX8_2253
   00500 Starch and sucrose metabolism
    AciX8_2253
   00520 Amino sugar and nucleotide sugar metabolism
    AciX8_2253
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AciX8_2253
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AciX8_2253
Enzymes [BR:gma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AciX8_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEU36571
JGI: AciX8_2253
UniProt: G8NW59
Position
2699430..2700434
Genome map
AA seq 334 aa AA seqDB search
MTQRQTHSPIAVHKNSVATEDTGYVAGIDLGATNLRLALADMSGAVLARWDSSTAGVRGA
EAVISLIKEGVESLLQKVSAPREALKAVAAGAPGITDVDAGIVIATSYLMGWRDVPLRAL
LEDAFNTPATVDNDVNLAAIGESWTGAAKGVRDFVFVAIGTGVGASLILNGSPYRGSAWA
AGEIGYMLVPGTSGIPGDRGEPGALESMIGGEGIKAEWQNLWSAESTALPKGLTATQIFD
HALAGDALAQTLLQQTARILAYAIYNMTLVLNCPLFVLGGGVGMHPALCSETQKMLEKLN
MRTQPELAHSALGTDAQLMGALRLALDTAGSLRR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacggcagactcacagccccatcgctgtccataagaactctgtggcaacagag
gacactggctatgttgccggcatagatcttggagcgacgaatttacgcttggcgcttgct
gatatgtccggcgccgtcctggcgaggtgggattcctctaccgcaggcgttcgtggtgca
gaggcggtgatctcgctcatcaaagaaggcgtggagagtctcctgcagaaggtttccgcg
ccgcgcgaggctttgaaggccgttgcagccggcgctcctggtattaccgacgtcgatgcg
ggaatcgtgatcgcaacgtcgtatctcatgggctggcgagacgttcctctgcgcgctctg
cttgaggacgccttcaacacgccggccacagtggataacgatgtgaaccttgcggccatc
ggtgaaagctggacgggtgcggcaaagggcgtacgcgatttcgtgttcgttgcgattggc
accggtgtcggcgcaagcctcattttgaacggcagtccctatcgcggaagcgcctgggct
gcgggcgaaatcggctacatgcttgtgcctggcacctcgggcatcccgggggatcgtggt
gaacccggagctctcgagagcatgatcggcggcgaaggcatcaaggcagaatggcagaat
ctttggagtgcggagagcacggcactaccgaaggggctgactgcgacccagatcttcgat
catgcgcttgccggagatgcgctggcgcagacccttctgcagcaaacggctcgcatcctg
gcctatgccatctacaacatgaccctggtgttgaactgcccgctcttcgtgttgggggga
ggcgtcggtatgcacccagcactctgcagcgagacgcaaaagatgctggagaaactaaac
atgaggacccagccagaactggcgcacagtgctttgggaacggacgcgcagttgatggga
gcacttcgtttggcgctcgatacggcaggctctcttcgcagataa

DBGET integrated database retrieval system