KEGG   Granulicella mallensis: AciX8_2525Help
Entry
AciX8_2525        CDS       T01664                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
gma  Granulicella mallensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gma00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:gma00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3081317..3083380
Genome map
AA seq 687 aa AA seqDB search
MNHPSPLRHYRNQLVRFGVLCLIASPFMSAQTSNTLLPKPAQMTVAAGSIPFTGNFTVSL
NGAHNPILEAATRRTLDALELSTGIPLGKGLQAPDATLTIQVQDPSGTRPTLDTDESYSI
HSTGNKIVLKAGNVFGALHGLETLQQLLQVEGGNYVIPAVQIDDAPRFPWRGFMLDVSRH
FMPLPVIYRTLDGMAAVKLNVFHWHLTDDQGFRVESKRFPQLTQVGSDHLFYTQDQVRAV
IAYASARGIRVVPEFDVPGHVTSWLIGMPELGSIQRPYALARTFGVWDGALDPTKDSTYQ
FLDAFIGEMADLFPDEYMHMGGDESNGKDWKANPQIVDFMKAHNMKSTEELQAYFSARVL
ELVKGHHKQMVGWDEILTPNTPKDAIIQSWRGVESLAVASKQGNRGILSAPYYLDGMKTS
ERMYLDDPIPDGSALTAEQQKLVLGGEACMWAEQITPQTVDSRVWPRTAALAERFWSPRE
TRDVPDMYRRLAVESLRLDALGLTHISGPQSGLRQLAGGEEGAAQLAVLASTLSPVSFGE
RYHQQRTSQLTPMGNPVDYLRPDPALRENLLLIADRYLHSTSPAEHSAARQQLESLFQSW
IDSGPRLDSLAADNPRLRQLSERRIQLVKLGTLGVQALKAIDSHKAPSAAWIEQQNALLK
EAGSHTELTDFVVLPPLQQLLEAAGKH
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacccgtcgcccctgcgtcattaccgcaatcaacttgtccgttttggggtactt
tgcttgattgcctctccctttatgtccgcacagacttcgaacacccttcttcccaagccc
gcgcagatgaccgttgccgccggttcgattcccttcaccggaaacttcacggtctcgctc
aacggagcgcacaatcccatcctcgaagcggcaacgcgccgcaccctcgacgccctggag
ctctctactggaatccccctgggcaaaggattgcaggctcctgacgcaaccctgacgatc
caggtgcaggacccctcgggcacgcgtccaacgctggacaccgatgaaagctactccatc
cattccacgggtaacaagatcgtcttgaaggccggtaatgtcttcggagctctccatggc
ctcgagaccttgcagcagcttcttcaggttgaaggcggaaactacgtcattcccgcggta
cagatcgacgatgctccgcgcttcccctggcgcgggttcatgctcgatgtgagccgccac
ttcatgcccttgccggtgatctaccgcacgctggatggcatggctgccgtcaagctcaat
gtcttccactggcatctcacggacgaccagggcttccgcgtcgaaagcaagagattcccc
cagctcacccaggtgggatctgaccacctcttctatacgcaggatcaggtacgcgccgtc
atcgcctatgccagcgcgcgcggcatccgtgtcgtgccggagttcgacgtccccggccac
gttaccagctggctgatcggcatgcctgagcttggcagcatccagcgtccttacgcactc
gcccgcaccttcggagtctgggatggagcactcgatcccaccaaagatagtacctatcag
ttccttgacgccttcatcggtgagatggctgacctcttccccgacgagtacatgcacatg
ggcggagacgagagcaacggcaaggactggaaggcgaatccgcagatcgtggacttcatg
aaggcgcacaatatgaagtccaccgaggaactgcaggcctacttcagcgcgcgcgtcctc
gagctggtgaagggacaccataagcagatggtcggctgggacgagatcctgacccccaac
acgccgaaggatgccatcatccagagctggcgcggtgttgagtcacttgccgtagcctcg
aagcaggggaacagaggtatcctctccgcgccctattacctcgatgggatgaagacttcc
gagcggatgtacctggacgatccgatccccgacggttccgcgctcacagccgaacagcaa
aagctcgttctcggcggcgaggcctgcatgtgggctgagcagatcaccccgcagaccgtc
gactcacgagtctggccgcgcacggccgcccttgcggaacgcttctggtccccacgcgag
acccgggacgttcccgatatgtatcggcgcctcgcggtcgaatcgctgcggctggatgcc
ctgggactcacccatatctccggccctcagtctggattgagacagcttgccggcggcgaa
gaaggagcggcccagcttgcggtactcgcctccacgctcagccctgtctccttcggcgaa
cgttaccaccagcagaggacctcgcagctcacgccgatgggtaatcccgtcgactacctg
cggcccgatcctgcccttcgcgagaatctccttctgatcgccgaccgctatctgcacagc
acctcgccggcagagcactcggcagcacgtcagcagctagagagcctcttccaatcatgg
atcgattccggtccccggctggatagccttgctgcggataatccccggctgcgtcaactc
tctgagcgccgcatacaactggtaaaactcgggactctcggcgttcaagcgctcaaggct
atcgactcgcacaaggccccaagtgcggcgtggattgagcagcagaatgcgctcctgaaa
gaagctggaagccacaccgagctgactgatttcgttgtccttcctcctctgcaacaactc
cttgaggctgctggaaagcactaa

DBGET integrated database retrieval system