KEGG   Granulicella mallensis: AciX8_2529Help
Entry
AciX8_2529        CDS       T01664                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gma  Granulicella mallensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gma00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3090831..3092495
Genome map
AA seq 554 aa AA seqDB search
MGAYLISGEGGCLPCGKPLDFHSSGVRLPSPNYLVKICRQPACTDHAERVFCISQTMKHV
LALDQGTTSSRAILFGHDGNIVGIAQHEFKQIYPDVGWVEHDPFDILTSQLTSAVEVLGK
ARVRPRDVVALGITNQRETTIVWDRETGKPVYNAIVWQDRRGAPLCKKLADDGAEETIRK
KTGLLIDPYFSATKIAWILDNVQGARDRANQGKLAFGTVDAWLIWNLTSGKRHLTDRTNA
SRTMLYNIVEDRWDQELLKLLNIPESMMPEVGWSSEAVGHVTTSLGLGDVEIAGIAGDQQ
SALFGQLCVSPGDAKNTYGTGCFLLQHIGDKFTLSNERLITTLACSPSKKLEYAMEGSIF
VGGAVVQWMRDNMHFFSKSSDVERAAASVKDADKVVFVPAFTGLGAPHWDPYASGMIIGL
QRSTEIGHIARAALESIAFQVADVIHAMDKDTKQPFRELRVDGGAAANDILMQFQSDLLQ
LPIRRPAVLETTASGAAYLAGLAVNFWGSTDEIAKLRGPDTMFEPKADRKEMDARQAKWQ
DAVKRAGGWNKETA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcctacctcatcagcggagagggcggatgcctgccgtgtgggaagccactcgac
tttcattcgtcgggggtacgtcttccctccccgaattacctcgtgaaaatatgtcgacaa
ccagcgtgcacggaccacgcagaaagggtattctgcatctctcagacgatgaagcacgta
ctcgcgctcgaccagggaaccaccagctcacgggcgatcctatttggacatgacggcaac
atcgtcgggatcgcgcagcatgaattcaagcagatctaccctgatgtcggctgggtagag
cacgatcccttcgacatcctgacttcgcagttgacctctgccgtcgaagtcctgggcaag
gcacgcgtgcgcccacgggatgtcgttgcactgggaatcacgaaccagcgcgagacgacg
atcgtctgggaccgggagacgggcaagccggtctacaacgccatagtctggcaggacagg
cgcggagctcctctctgcaagaagctcgccgatgacggcgcggaagagaccatcaggaag
aagacaggcctgctcatcgatccttacttctccgccaccaagatcgcctggatcctcgac
aacgtgcagggcgcccgagaccgggcgaaccagggcaagcttgctttcggcacggtagac
gcctggctgatctggaacctgaccagtggcaagcggcacctcaccgaccgcacgaacgcg
agccgcacgatgctctacaacatcgtcgaggatcgctgggaccaggagctattgaagctg
ctgaacattcctgagagcatgatgccggaggtcggctggtcgagcgaagccgtgggccac
gtgaccacatcgcttggactcggagatgtggaaatagccggcattgcgggcgaccagcag
tcggcgctgttcggccagctctgtgtctctcccggcgacgcgaagaacacctatggcacc
ggctgcttcctgctgcaacacatcggcgacaagttcacgctctcgaacgaacggctcatt
actacactcgcctgcagcccgagcaaaaagctcgagtacgcgatggaaggcagtatcttc
gtgggcggcgcggttgtacagtggatgcgcgacaacatgcacttcttttccaaatcgtcg
gacgttgagcgtgctgccgcctcggttaaagacgcggacaaggttgtcttcgttcccgcg
ttcaccggcctgggcgctccacactgggacccttatgccagcggcatgatcatcggcctc
cagcgcagcaccgagatcggccacatcgctcgcgctgccctcgaaagcatcgccttccag
gtggccgacgtgattcacgctatggacaaggacacgaaacaaccgttccgggagcttcgc
gtcgatggcggtgcagccgcaaacgacatcctgatgcagttccagtccgacctgcttcag
cttccgatacggcgcccggcagtgctggagaccacggcctcaggagctgcatatcttgcg
gggctggcggttaatttctggggaagcacagacgagatcgccaagctgcgaggaccggat
acgatgtttgaaccaaaggccgaccgaaaagagatggatgcccgtcaggccaagtggcag
gatgcagtcaaacgcgcaggtgggtggaacaaggagacggcatga

DBGET integrated database retrieval system