KEGG   Granulicella mallensis: AciX8_2675Help
Entry
AciX8_2675        CDS       T01664                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gma  Granulicella mallensis
Pathway
gma00260  Glycine, serine and threonine metabolism
gma00750  Vitamin B6 metabolism
gma01100  Metabolic pathways
gma01110  Biosynthesis of secondary metabolites
gma01120  Microbial metabolism in diverse environments
gma01230  Biosynthesis of amino acids
Module
gma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciX8_2675
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AciX8_2675
Enzymes [BR:gma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AciX8_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NOB1_Zn_bind DUF1610 HypA
Motif
Other DBs
NCBI-ProteinID: AEU36985
JGI: AciX8_2675
UniProt: G8P161
Position
complement(3282250..3283653)
Genome map
AA seq 467 aa AA seqDB search
MSMQSHMLRCTGCAQRIAGEAARSDFRCPDCGDLYEVEYPWSESASGTTAKDVPVNRPNP
FALRHLWQERRTSTLAVDQSGVWRFRDLLPIVADDQAITLREGNTPLYELPKSAAALGMN
WLLAKHQGMNPTGSFKDTGMTAALSVAVSRGFEWVACASTGNTSAAMAAYAARAGLRSMV
LIPEGKIAWGKLSQSMDYGSMTVQLRTDFDGCVRVLTELVRRAPIYLLNSVNPYRLEGQK
TPAFEMLEQTDWQVPHHVIVPGGNLANCAALGKGFAEMKHLGFISRVPKISVIQAEGANP
LYRAMQANGGESLEPVVADTRATAIRIGNPASWRKTVRILKANGGWCEQVNEREIALAKA
EIGAEGIGCEPASAVTLAGLKKLVAAGHVGREETAVLLLTGHTLKDPEYTIQYHRGQLFN
AAELAGATPAELGQHKAFQKAPLVLDANVDDVLRALDAVAATAGQTA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgcaatcacacatgcttcgatgcacgggctgcgcccagagaatagctggtgaa
gcggctcgtagcgacttccgttgcccggactgcggcgatctgtatgaagttgagtatccc
tggagtgaaagtgcttcgggcactacggctaaggatgtaccggtcaatcgccctaaccct
tttgctttgaggcatctgtggcaggagcgtagaacctcgactttagctgtggaccagagc
ggtgtctggcgttttcgtgacctgctgccgattgtcgccgacgatcaggccattacgctt
cgcgagggcaatacgccgctctacgagctgccgaagtctgctgccgcgttagggatgaac
tggctgctggccaagcaccagggcatgaaccccacagggtcgttcaaggacacggggatg
accgcggcgctgtcggtagcagtctcgcgtggcttcgagtgggtagcctgcgcctcgacc
ggcaatacctcggcggcgatggcagcctatgctgcccgtgccggtctgcgcagcatggtg
ttgatccccgaaggcaagatcgcctggggtaagctctcgcagtcgatggactacggctcg
atgaccgtccagttgcgcacggacttcgatggctgcgtgcgcgtgctgacggaactcgtg
aggcgtgctccgatctatctgctgaactcggtgaatccttacagacttgagggccaaaag
acgcccgcgttcgagatgctggagcagaccgattggcaggtgccgcatcacgtcatcgtt
cccggcggcaatctggcaaactgtgccgccctgggcaagggcttcgcggagatgaagcat
cttgggttcatctcgcgtgtgccgaagatcagtgtcatccaggccgagggagcgaatccg
ctctaccgcgccatgcaggcgaacggtggggagagcctggagcccgtagtcgctgataca
cgggccacggcgatccgtatcggcaatcccgcctcctggagaaagaccgtgcgcatcctc
aaggccaacggcgggtggtgcgaacaggtcaatgaacgagagattgcgttggccaaagct
gagattggcgccgagggtatcggctgcgagcctgcgtcggcggttacgctggcgggcttg
aagaagctggtggcggcaggccatgttggcagggaagagacggcggtgctgttgctgacc
ggccacaccctgaaggatcccgagtacaccatccagtaccatcgcggccaactgttcaat
gcggcggaacttgcaggtgcaacccctgcagagctgggccagcacaaggcctttcaaaag
gctccgctggtgctggacgcaaatgtggatgacgttctgcgggcgctggatgcggtggct
gctacggcgggccagaccgcatga

DBGET integrated database retrieval system