KEGG   Granulicella mallensis: AciX8_2696Help
Entry
AciX8_2696        CDS       T01664                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gma  Granulicella mallensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gma00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gma00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gma00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3316646..3318922
Genome map
AA seq 758 aa AA seqDB search
MKNILNTLLSSDKSSANGFHLVYRMLLATAIFIAPLCLRAQAQTSSIHFDKQTKVFRIDA
ADVSYIFGVNENKQVQTLYWGKRLSAADTFAASKSAPGASSSDPSIDTTRQEFVAWGGGL
YVEPDLKVTFPDGNRDLVLQYVSHTIAGNHLTLQLKDVSRDVYVELQYEIDSETGILRRS
AEVQNKTSLPLTIEQIASGTWTLPRAQDYRLHYLTGRWAGEWNLREQAIQPGKITLESRR
GSTGAQNNPWFAIDRNSSNDQDQGDVWFGALGWSGSWQINIEQDQIQQVRVTGGPNSFDF
GYRLAAGESLQSPYFYAGYSHDGIGGASRLLHRFELSSILPGASHPKLRPVLYNSWEATG
FNVDEAGQEALAEKAASIGVERFVVDDGWFGQRADDHAGLGDWYVNPVKFPHGLKPLIDK
VHSLGMDFGLWIEPEMVNPDSDLYRKHPDWILNFTGRPRSEGRHQFVLNLARPDVREYVF
NFIDKLLDENDIAFLKWDYNRNWSEPGWPAVSPDEQKKVYVTYTQNLYSILEELRRKHPK
IEIESCSGGGSRVDLGIMRYTDEVWPSDNTDAFDRLKIQDGFTYAYTPGVMMAWVTDTPT
QINHRTVSLDYRFLSSMQGSLGIGANLNDWKPEDFATAKKMVAQYKQIREIVQRGSLYRL
ISPRDGSEQSVTETVSQDQTRAVAFAFLHSSEMLYPFPRIYLRGLKPDALYRIEALDGKL
AGDSPTVASGAFWMQQGVDVDLKGDFQAAAFSLKIVSQ
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattttgaatacccttttgtcctctgataaaagcagcgccaacggatttcat
cttgtgtacaggatgttgctggcgacagcgatcttcatcgctcccctgtgcctccgggct
caggcgcagacatcgtctatccacttcgacaagcagacgaaggtcttccgcatcgatgca
gccgacgtgtcttatatcttcggcgtcaatgagaacaagcaggttcaaactctttactgg
ggcaagcgtctcagcgctgcagacacctttgctgcctctaagtccgccccaggagcttcg
tcctccgatccatccatagacacgacacggcaagagtttgtcgcatggggtggaggactg
tacgtcgagccggatctgaaggtcacctttcccgatggaaaccgagatttagttctgcaa
tacgtctcgcataccattgccggtaaccatctgaccctgcagctcaaggacgtatcgcgc
gacgtctacgtcgaactgcagtatgagattgactcggagaccggcatcctgcgccgttcg
gcagaggtgcagaataagacctccctgccgttgacgatcgagcagatagcctccggcacg
tggacactacctcgcgctcaggattatcgactgcactaccttacagggcgctgggccgga
gagtggaaccttcgtgagcaggcaatccaaccgggcaaaattactttggagagccggcgc
ggatcgactggagcgcaaaataatccctggttcgcaatcgaccgcaacagctcgaacgat
caggatcagggcgatgtctggtttggcgccctcggttggagcgggtcctggcagatcaat
atagaacaggatcagattcaacaggtacgcgtaaccggcggccctaatagctttgacttc
ggctatcgcctggccgcgggcgaaagcctgcaatcgccctacttctatgcaggctactcg
catgacggcattggtggagcttctcgcctgctgcaccgatttgaactctccagcatcctg
ccaggcgcatctcaccccaagttgaggcctgtgctttataactcatgggaagctaccggt
tttaatgtcgacgaagcgggccaggaagcccttgcagagaaggccgccagcatcggggta
gagcgctttgtcgtagacgatggctggtttggacagcgcgcggacgatcatgccgggctg
ggcgactggtatgtgaatcccgtaaagtttccgcatggcttgaagcctctgatcgacaag
gtgcattcgctggggatggactttggcctatggattgagccggagatggtgaatcccgat
tcagacctctaccgcaagcatcccgactggatattgaacttcaccggaagaccgcgcagc
gagggacggcaccagttcgtactgaatcttgccagacccgatgtccgtgagtatgtcttc
aacttcatcgacaagttactcgatgagaatgacattgcctttctcaagtgggattacaac
cgtaactggtcggagccaggctggcctgcggtctcacccgacgagcaaaagaaggtgtac
gtcacctacacgcagaacctctattccatcctggaggagttgcgcaggaaacacccgaag
atagagatcgaaagctgctccggtggaggcagccgtgtcgatctcggcatcatgcgctac
accgatgaggtatggccctccgataacaccgatgccttcgaccgcctgaagatacaggac
ggatttacctatgcctacacgcccggcgtgatgatggcctgggtaactgacacgccaact
cagatcaatcatcggacggtttctctggactatcgcttcctttcctccatgcagggatcg
ctgggcattggagcaaacctcaacgactggaaaccggaagactttgccacggcaaagaag
atggtggcacagtacaagcagattcgcgagatcgtgcagcgcggctctctgtaccgcctg
atttcgccacgagatggcagcgaacagtcggtcacagaaacggtctcacaagaccagaca
cgggctgtagccttcgccttcctgcattcgagcgaaatgctctacccttttccgcgaatc
tatcttcgtggtctaaaaccggatgccctctaccggattgaagcactggatgggaagctg
gccggcgattcaccgacggttgccagtggagccttctggatgcagcagggcgttgatgta
gacctcaaaggggacttccaggccgctgcgttctccctgaagatcgtctcccaataa

DBGET integrated database retrieval system