KEGG   Granulicella mallensis: AciX8_2759Help
Entry
AciX8_2759        CDS       T01664                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gma  Granulicella mallensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AciX8_2759
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AciX8_2759
Enzymes [BR:gma01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AciX8_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3389727..3390287
Genome map
AA seq 186 aa AA seqDB search
MPTLYDLPLTTLSGSPTTLADFSGKALLIVNVASRCGLTPQYTDLETLYQQFKDKGFVIL
GFPANDFAGQEPGSNQEIAKFCSTDYPVTFPVFAKIAVTGPEQHPLYAELTSAAPEHVVN
DAGFRGNISGYLKSQGLPEPAPLPAVLWNFEKFVVGRDGTVIARFAPDMLPSDPRIVSAI
EQALSN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgccgactctctacgacctcccgctcacgaccctctccggctcccccaccaccctcgcc
gacttctccggcaaggccctgctgatcgtcaacgtcgcctcccgctgcggacttaccccc
cagtacaccgatctcgaaaccctctatcagcagttcaaggacaaggggttcgtaatcctc
ggcttccccgccaacgacttcgcaggccaggaacccggctccaatcaggagatcgccaag
ttctgctcaactgactatcccgtcaccttccccgtgttcgccaagatcgccgtcaccggc
ccggaacagcacccgctctacgccgagctcacctcggccgcgcccgagcatgtcgtcaac
gacgcaggcttccgcggcaacatctccggctacctcaagtcccagggcctccccgagccc
gcaccgctccccgccgtcctctggaacttcgaaaagtttgtcgtaggccgtgacggcacc
gtcatcgcccgctttgcccccgacatgctccccagcgatccccgcatcgtcagcgcaatc
gaacaagccctgtccaattag

DBGET integrated database retrieval system