KEGG   Granulicella mallensis: AciX8_3087Help
Entry
AciX8_3087        CDS       T01664                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
gma  Granulicella mallensis
Pathway
gma00860  Porphyrin and chlorophyll metabolism
gma01100  Metabolic pathways
gma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AciX8_3087
Enzymes [BR:gma01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AciX8_3087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 VWA_2 Sigma54_activat VWA MCM AAA CPT AAA_22 TsaE Sigma54_activ_2 AAA_33 AAA_29 AAA_16 NACHT Zeta_toxin AAA_2
Motif
Other DBs
NCBI-ProteinID: AEU37390
JGI: AciX8_3087
UniProt: G8NS96
Position
3811533..3813254
Genome map
AA seq 573 aa AA seqDB search
MKPFIYPFSAIAGQQEMKLALLLAAVDWRISVLLRGDKGAGKTTTARALAALLPQPSPFI
NLPIGATEDRLLGGLHLERALKGDPALKPGLLSEAHGGVLYVDEVNLLPAHLGDTLLDTA
SSGVNVIEREGFSASHAAEFVLLGSMNPEEGLLRPQLLDRFALAVNITAPLEPAERQTVV
ERRIAFDRDPAVFLADWAEMEQQLREQILSARAQLSGVLCSQEILAQISAAVCERGVRSL
RADLAAVRASIAYAALTGDASVQPHHVAAVLPLVLVHRAQERSRPPAPQPPALQTPQDAP
SEASDKDQAQNAGEAQERIFAPREIKTPKVQAKFEDAAARGNSAPAQAHQPGPAVGARRS
ETPVELDLRATLNHAVMETGSLQPRLQDLHERVRQPATGTRYLFVIDSSGSHAAQERMRL
VKGAASSLLTRSFKNGDEAAIIVFRGTAAQVVLEPTRTLPEAITAFEYLPTGGRTPLAHA
LDLAQNYLTPATVLVLLTDGRANVSLGEGDPWQEALEIASRIKATALVVDTENSAERLGR
PRQLAEVMAAEYVGLENLESSDAAILTLHRLSG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctttcatctatcccttctccgccatcgccggacagcaagagatgaagctggcc
ctgctgctcgcagccgtggactggcgcatcagcgtgctcctgcggggagacaaaggcgcc
ggcaaaaccaccacggcgcgcgcgcttgccgctcttctgccccagcccagccccttcatc
aacctgccgatcggtgcgaccgaagaccggctgctcggcggcctgcacctggagcgcgcc
ctcaaaggcgatcccgcgctaaagcccggtctgctgtcagaagcgcacggcggcgtcctc
tacgtggacgaggtcaatcttctcccagcccatctgggcgataccctgctcgataccgct
tcgagcggagtcaacgtgatcgagcgcgaaggcttcagcgcctcccatgcagccgagttc
gtcctgctcggcagcatgaacccggaggagggcctgctgcggccccaactgctcgaccgt
tttgcgcttgcggtgaacattaccgctcctctggagcctgccgaacggcaaaccgtcgtc
gaacgccgcatcgccttcgatcgcgatccggccgtcttcctcgcggattgggcggagatg
gaacagcagcttcgcgaacagatcctcagcgcacgcgcacagctctccggcgttctgtgc
tcgcaagagattctcgcgcagatcagcgccgccgtctgcgaaaggggcgtgcgctccctg
cgcgccgatctcgcggcagttcgagcctccatcgcctacgctgccctcaccggcgatgcc
tcggtacagccccaccatgtagccgccgtactgccgctggtactcgtgcatcgcgcccag
gaacgaagtcgtcccccggcaccccagccgccagcactccagacaccgcaagacgctcct
tccgaggcctccgacaaagaccaggcgcagaacgcaggcgaggcccaggaacgaatcttc
gctccaagggagatcaagacgcccaaggtgcaggcgaagtttgaagacgccgcagcacgc
ggcaacagcgctccggcgcaggcgcaccagccggggcctgcggtcggagcacgccggtct
gaaactcccgtagagctcgaccttcgcgctaccttgaaccacgccgtaatggagaccgga
agccttcagccgcgcctgcaggatcttcacgaacgagtgcggcagccggcgacaggcacc
cgatatctcttcgtcatcgattcaagcggctcccacgcagcacaggagagaatgcgcctc
gtcaaaggcgcggcttccagcctgctgacacgctctttcaaaaatggggacgaggctgcc
atcatcgtctttcgcggcactgcagcgcaggtggtgcttgagccgacgcggacactcccc
gaagccatcaccgccttcgagtatctgcccacgggcggcagaacccctttggcccatgcc
ctcgatctcgcacagaactacctgacaccggcaacggtcctggtgcttctcaccgatggg
cgagcaaatgtctctcttggagagggcgacccctggcaggaggcattggagattgcgagc
cggatcaaggccaccgccctcgtggtcgataccgaaaactccgccgaacggttggggcgg
cctcgccagttggcagaggtcatggccgcagagtatgtggggctggagaatctcgaatcc
agtgatgcggcgattctcaccttgcatcggctttcgggataa

DBGET integrated database retrieval system