KEGG   Granulicella mallensis: AciX8_3404Help
Entry
AciX8_3404        CDS       T01664                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gma  Granulicella mallensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AciX8_3404
Enzymes [BR:gma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AciX8_3404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4277236..4278003)
Genome map
AA seq 255 aa AA seqDB search
MIHPRVLVTRAPHQASELAEQLRMAGIDPILIPAIETTSPVSFAALDAALQHLDTFHWLL
FTSANAVEVFARRLLSPSGVRMPRMAAVGQATARAVEAAGLTVDLIPQQAVAESFAQALL
PYASQPDGSSTRFLLVRAEQARDHLPETLGAAGAEVIIAPAYRTVIPESSIPAIREMFSR
PENYPDAVTFTSSSTAQNLFALLEAAGATLPPQILRVSIGPITSQTLVQLGFPPHVEAKE
ASVVSLAAAIVEHFK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatccatccccgtgtcctcgtcacgcgcgccccgcatcaagcctctgaactcgctgaa
caactgcgcatggcgggcattgatcccattttgattccggccatcgaaaccacatcgcct
gtcagctttgctgcactcgacgctgcgcttcaacatctcgatacgttccactggcttctc
tttaccagtgccaatgccgttgaagtcttcgcacgcaggttgttatctccgagcggggtg
cggatgccgcgaatggcggccgtcggccaggctacagctcgcgctgttgaggccgctggt
ctgaccgtagaccttatcccccagcaggctgttgccgagtcttttgctcaggcgcttctg
ccttatgcgtctcagcctgatggctcttccacgcgttttctgctggtacgtgccgaacag
gctcgcgatcatctccctgagaccctgggtgctgccggcgctgaggtaatcatcgctccg
gcctaccgcactgtcattcccgagagctcgattccggcgatccgcgagatgttctctcgc
cctgagaactatccggatgctgttacctttaccagttcgtccacggcgcagaatcttttt
gcgctgctggaagccgctggggctacgcttccgccacagatcctgcgagtctcgattggg
ccgattacgtcacagacgctcgttcagctaggctttccaccgcatgtcgaggcgaaagaa
gcgagtgtggtttctctggcggctgcaattgttgaacactttaagtag

DBGET integrated database retrieval system