KEGG   Granulicella mallensis: AciX8_3428Help
Entry
AciX8_3428        CDS       T01664                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gma  Granulicella mallensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gma00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gma00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gma00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4312940..4314127)
Genome map
AA seq 395 aa AA seqDB search
MPRLFVKRLAILASVLLCAHVGIAQSSLVPTPPMGWNSWNHFFQHVTDADVRAAADAMVA
NGMRDAGYVYVNIDDGWQGTRRPDGTIQSNDRFPDMKTLADYVHTRGLKLGIYSSPGLKT
CAKFEGSYGHEMQDAKTYAAWGIDYLKYDLCSFGDKLTVAGNGDQAAPAAFAAQQEAYRK
MHDALVAAGRPIVFSLCQYGMSNVWEWGPEVGGNLWRTTGDISDKYDRMALIGFSQAGLS
RYAGPGHWNDPDMLEVGNGGMTLDEYRTHMSLWAILAAPLLAGNDLRHMKPEHLAILENK
DAIAIDQDSLGKQGDRVSALGPYELWTKPMSHGRTAIALFNRGELAHTMRVNLRELGISP
GAHIRNVWANADLPFSDIINPIIPKHGVVLLLVTR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtctgtttgtgaaacgtctcgccattctcgcatccgtgcttctctgcgctcac
gtcggcatcgcacagtccagcctcgtgcccacgccaccgatgggatggaacagctggaat
catttctttcagcatgtgacagacgccgatgtgcgcgccgcggctgacgctatggttgcc
aatggcatgcgcgatgccggctatgtctacgtcaacatcgatgacggctggcagggaact
cgccgccccgatggcactatccagagcaacgatcgctttcccgacatgaagactctcgcc
gactacgtccacacacgtggcctgaagcttggcatctactcctcaccaggactcaagacc
tgtgcgaagttcgaaggcagttacggccacgagatgcaggatgcgaaaacatacgccgcc
tggggcatcgactatctcaagtacgacctctgcagctttggcgataagctcaccgtggcc
ggtaacggtgaccaggccgcgcctgctgcctttgccgcgcagcaggaggcgtaccgcaag
atgcatgatgccctggttgcggctggccgtcccatcgtcttcagcctttgccagtacggc
atgagcaacgtctgggagtggggcccggaggtcggcggcaacctctggcgcacgactggc
gacatctccgataagtacgatcgcatggctctcatcggcttctcgcaggccggtctctcc
cgctacgcaggccccggacactggaacgatcccgacatgcttgaggtcggcaacggcgga
atgacgcttgacgagtacagaacccacatgagcctctgggctatccttgccgctccgctg
ctcgccggcaacgaccttcgccacatgaagcccgagcatctcgctatccttgagaacaaa
gacgccatcgcaatcgaccaggacagccttggcaaacagggggatcgtgtgtccgcgctc
ggcccctatgagctctggacgaagcccatgtcccacggccgcacggccattgcgctcttc
aatcgcggcgagcttgctcacacgatgcgcgtcaatctgcgcgagctcggtatatcgccc
ggcgcacacatccgcaatgtctgggccaacgccgatctgccgttcagcgatatcatcaac
cccatcatcccgaagcacggtgtcgtgctgcttctggttactcgctga

DBGET integrated database retrieval system