KEGG   Granulicella mallensis: AciX8_3463Help
Entry
AciX8_3463        CDS       T01664                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
gma  Granulicella mallensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AciX8_3463
Enzymes [BR:gma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AciX8_3463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4367932..4369815
Genome map
AA seq 627 aa AA seqDB search
MKNFSPAKKYFHKFLAITLLPLLSGAVRGQVATASAAPLTVGTSGFLLKDKPFRIVSGEL
EYARIPRPYWRDRLRKAHAMGLNAITIYVFWNIHEPTPEVYDFSGQNDVAEFVREAQQEG
LYVILRPGPYVCAEWDLGGYPAWLLKDHEMKLRSLQPEFKAAATRWMLRLGQELTPLQAS
RGGPILAVQVENEYGSFGDDHEYMKWVHELVLQAGFGGSLLYTGDGADVLKQGTLPSVFA
GIDFGTGDAARSIKLYKAFRPQTPVYVAEYWDGWFDHWGEKHQLTDAAKQETEIRSMLEQ
GDSISLYMVHGGTSFGWMNGANNDHDGYQPDVSSYDYDAPLDESGRPRPKYFRLRNIINE
ITNQTPIPVPDSPPLITVPAIHLDEAQSLWNTLPKAIESEAPLSMEDVDQSYGYILYRTK
INGLGTGQLTFNELHSYARIYVDGKLAGVLDRRLGQKSLPLQITGTHRLDILVENSGRIN
FKPIIRTERAGALGQISFKGAALNHWSIYPLPFAPPPEKGYKKNVCTGPCFYHAEFSTPN
PGDTFLNTEQLVKGVVWVNGHLLGRFWDIGPAGALYVPGVWLHQGKNELTVFDLNGGRNL
QIEGQDHATYFEPKPESVTPVNTAPKP
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttttcccctgcaaaaaaatattttcataagttcctcgccatcacccttctc
cccctcctttcgggtgccgtgagaggccaggtcgcaacagcctcagcagccccccttacc
gtgggcacaagcgggtttcttctcaaggacaaacccttccgtatcgtctcgggcgagctg
gagtacgcccgaatcccgcgaccgtactggcgcgaccggctgcgaaaagcccacgccatg
ggcctcaatgcaatcaccatctatgttttctggaacatccatgaaccgacgccggaagtc
tacgacttctccgggcagaacgacgtggcggagtttgtccgtgaagcgcagcaagagggc
ctgtacgtcatcctgcggccagggccgtacgtttgcgcggagtgggatttaggcggctat
cccgcctggctgctgaaggatcatgagatgaaactgcgtagcctgcagccggagttcaag
gcagcggcaacacgctggatgcttcgtctgggccaggaactgactcccttacaggcaagc
cgaggcggcccgatcctcgcggtgcaggtcgagaacgagtacggttccttcggcgacgat
cacgaatacatgaagtgggtgcatgagcttgtgctccaggcaggcttcggaggctccctg
ctctataccggcgacggagctgatgtgctcaaacaggggacattacccagcgtcttcgcg
ggcattgatttcggcacaggggacgcagcgcgctccatcaaactgtataaggcgttccgg
ccccaaacacctgtttatgtcgccgaatactgggacggatggttcgaccactggggcgaa
aagcaccagcttacggatgctgccaagcaagagaccgagatccgttccatgctggagcaa
ggggactccatcagcttgtacatggtgcatggcggcacgagcttcggctggatgaacgga
gccaacaacgatcacgatggctatcagcccgatgtctccagctacgattacgacgcgcct
ctcgacgagtccggccggcctcggcccaagtactttcgactgcgcaacatcatcaacgag
attacgaaccagacgccgattccggtgccagactctcctccacttatcaccgttccagcg
atccatctggacgaggctcagtcactgtggaacacactgccgaaggcgattgagtcagag
gctccgttgtccatggaggacgtagaccagagctatggctacattctctaccggacaaag
atcaatggcttgggtaccggtcagcttaccttcaacgagctacacagctacgcaagaatt
tacgtggatggaaagctcgcaggcgtgctggaccgccgccttggacagaagagccttccg
ctacagataaccggaacccatcgcctcgacatcctcgtagagaactccgggcgcatcaac
ttcaaaccgatcatccgcaccgagcgcgccggcgctctcggccagatctccttcaagggt
gcagcgctcaaccactggagcatctatcccctgccctttgctccaccgccggaaaagggc
tacaagaagaatgtttgtacgggcccctgcttctaccatgcggagttctccaccccgaac
cccggggacacattcctcaataccgagcagctcgttaagggcgtggtgtgggtgaatgga
catctcctcggcaggttctgggatattggaccggccggcgctttgtacgttccgggggtg
tggctccatcaagggaaaaacgagcttaccgtgttcgacctcaacggagggcgtaatctg
cagatcgaaggtcaggaccacgctacctactttgagccaaaacctgaatccgtcaccccg
gttaacactgctcccaaaccctag

DBGET integrated database retrieval system