KEGG   Granulicella mallensis: AciX8_3614Help
Entry
AciX8_3614        CDS       T01664                                 

Definition
lysophospholipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gma  Granulicella mallensis
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:gma01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4582027..4582716
Genome map
AA seq 229 aa AA seqDB search
MLPILAVLCASLALSGCKSDTAGPAETSQNTQQPVPQRPVAAAPVSDRPVIVCFGDSLTA
GYGTDPGQSYPDYLQQRLDDAGFHYHVVNAGVSGNTTKDGLNRIARVIAQHPELVVVEFG
GNDGLRGLQLEQTQQSLASIVEQLQASGTKVVLAGITLPPDYGPDYIAKFNAMYPALAKK
YHVPLLPFLLQGVYGVPGDMQDDSTHATAKGNQQVAVNVQRLIEPLLKR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctatcttagctgtgctctgcgcatccctggcgctcagcggctgtaagtccgac
acggccgggccggcagagacaagccagaacacgcagcagcccgtcccgcaaaggcccgtg
gccgccgctccggtatcggatcgccccgtcatcgtctgtttcggcgatagcctgaccgca
ggctatgggacagaccccggccagagctatccggattatcttcagcagaggctcgacgac
gcaggctttcactatcatgtcgtaaatgccggggtaagcggcaacaccacaaaagacggc
ctgaaccgcatcgctcgggtaatcgcgcaacatcccgaactggttgtggtcgaatttggc
ggcaatgacggtctacgcggcctgcaactcgaacagacccagcagagccttgcgagcatc
gtcgaacaactgcaggccagcggtaccaaagtcgtactcgccggaattaccctgcccccg
gactacggtcccgattacatcgcaaagttcaacgcgatgtatccggcactggcgaaaaag
tatcacgtgccgctgctcccgttcttgctacagggagtgtacggcgtgcccggcgacatg
caggacgacagcactcatgccactgcaaagggcaatcagcaggttgcggtcaatgtccag
cgcttgatcgagcctttgttgaagcgctaa

DBGET integrated database retrieval system