KEGG   Granulicella mallensis: AciX8_3844Help
Entry
AciX8_3844        CDS       T01664                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gma  Granulicella mallensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AciX8_3844
Enzymes [BR:gma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     AciX8_3844
    3.5.1.-  
     AciX8_3844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4864028..4864663
Genome map
AA seq 211 aa AA seqDB search
MPNILRPTDALLIIDMQLDFLPGGPLAVHDGDSIIPGIKALAARFDHVILTQDWHPAAHI
SFASTHGKQPFTDTIEAPYGTQTLWPDHCLQGSRGAEIHPDLALPHAELILRKGFRQNID
SYSAFTENDGATPTGLAGYLRERGLKRLFFAGLAYDFCVGFSALAAAKLGFEALVVEDLS
RAIDLPGTIDAANQAFASLSIQRLASSELLS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatatcctccgccccaccgacgcgctcctcatcatcgacatgcagctcgacttc
ctgcccggcgggcccctggccgtccacgacggcgactccatcattcccggcatcaaggcg
ctggccgccagattcgaccacgtgattctcacgcaggactggcacccggcagctcatatc
tccttcgccagcacacacggcaagcagcctttcaccgacacgatagaagctccctacggc
acccagaccctctggcccgaccactgcctccagggttcacgcggcgcggagatacacccc
gatctcgcccttcctcacgccgaactcatcctgaggaagggcttccggcagaacatcgac
agctactccgccttcaccgaaaacgacggcgcgacacccaccggcctcgcgggctacctg
cgcgagcgcggactgaagcggctcttcttcgccggcctcgcctacgacttctgcgtcggc
ttctccgcgctggccgcagccaaactcggcttcgaggctctcgtcgtcgaagacctcagc
cgcgccatcgatctgcccggcacgatcgacgccgccaaccaggccttcgccagccttagc
attcagcgcctcgcctcctcggagttactctcttga

DBGET integrated database retrieval system