KEGG   Granulicella mallensis: AciX8_3854Help
Entry
AciX8_3854        CDS       T01664                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gma  Granulicella mallensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AciX8_3854
Enzymes [BR:gma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AciX8_3854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4871561..4872718
Genome map
AA seq 385 aa AA seqDB search
MKKIALLGSTGSIGQSTLSICESHPDRFHPIALAAGSNLEVAFAQCQRWRPQVVSIATEA
LADELSARLKDAGINGIEVVYGTAGTVRVATLPEADFVVSAIVGVAGLEATYAAVLAGKT
VGLANKECLVAAGDLILAAAREHSVDLLPIDSEHNAIHQCLRGGAASEVKQIWLTASGGP
FRNTPLADFGHITPAQALKHPTWVMGQRITIDSATMLNKGLEIIEACRLFNLPPAQVRVT
VHPQSTIHSLVEYVDGSILAQISVTDMRLPILYALAWPERVPSDLTFDMAALSHLDFQQP
DFERFPCLRLAYEAAAASQNHCIALNAADEIAVEAFLAGKLPFLGIPRTIEQVLALTTSG
SPASIPEVLAADRAARELARELVAR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagatcgctcttctcggctcgaccggctccattggccaaagcaccctcagcatc
tgcgagtcccacccggaccgcttccatcccatcgccctcgccgccggatcgaacctcgaa
gtggccttcgcccagtgccagcgctggcgtccccaggtcgtctccatcgccaccgaagcg
ctggccgatgagctctccgcgcgccttaaggacgctggaatcaacggcatcgaagtcgtc
tacggcacagccggaacagtccgcgtggcgacgttgcccgaggccgacttcgtcgtgtcg
gccatcgtcggcgtcgctgggctcgaagccacctatgcagctgtgctcgccggcaagacc
gtcgggctggccaacaaagagtgcctcgtcgccgccggcgacctcattctcgccgccgcc
cgcgagcacagcgtcgacctgctgcccatcgattccgagcacaacgccatccaccagtgc
ctgcgcggaggtgcggccagcgaggtcaaacagatctggctcaccgcctcgggcggcccg
ttccgcaacaccccgctcgcggacttcgggcacatcacgcctgcccaggcgctcaagcac
cccacctgggtcatgggccagcgcatcaccatcgactccgcgacgatgctcaacaagggc
ctcgagatcatcgaagcctgccgcctcttcaacctgccgcccgcccaggtgcgcgtcacc
gtgcatccgcagtcgacgatccactccctcgtcgagtacgtagacggttccatcctcgcg
cagatctcggtcaccgacatgcgcctgccgatcctctacgccctcgcctggccggagcgc
gtgccgagcgacctgactttcgacatggcggctctatcgcacctcgacttccagcagccc
gacttcgagcgcttcccctgcctgcgcctcgcctatgaagctgcagccgcctcgcagaac
cactgcatcgccctgaacgccgccgacgagatcgcggtcgaggccttcctggccgggaag
ctgccattcctgggcatcccacgtacaatcgaacaagtgctcgcgctcaccaccagcggt
tctccagcgtccatccctgaggtgctcgccgcggatcgcgctgcacgcgaacttgcaaga
gagctcgtcgcccggtaa

DBGET integrated database retrieval system