KEGG   Granulicella mallensis: AciX8_3884Help
Entry
AciX8_3884        CDS       T01664                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
gma  Granulicella mallensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AciX8_3884
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AciX8_3884
Enzymes [BR:gma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     AciX8_3884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4907584..4909098)
Genome map
AA seq 504 aa AA seqDB search
MQWVEAISGVRVLEAAGSRAIDVRGVQYDSRRVTAGDVFVAMKGGSSDGNRFIDTAMRQG
AAAIITDSAETFAALRERQPELAVALVEHGRRALAEVSAAVFGRPEQTLKLSAVTGTNGK
TTTAFLLEQMLRSVGRKSVLMGTIETHIGDQVRESEHTTPESRDVLAVFAEGVRAGCTEV
VMEMSSHALEQERVWGLPVDVAIFTNLTQDHLDYHGTMEAYFQAKARIFAGVGALPPRVA
VINLDSEYGDEMCHEFRGATLMTYGMGEFGNYRAENVSLALGDTRFDFVTPEGRIAMHSP
LSGRVNVENLLAASCAALARGLTLEQVAHAAEMLHQVPGRFQVVPGSKAAGFFVVVDYAH
TDDALRNLIALARESVVGHGGRAITLFGCGGDRDKTKRPKMGRAAGEDSDLVVVTSDNPR
SEEPMTIINEALLGVRETQTTFIVEEDRRAAIEVAIRSAKPGDIVLLAGKGHEKVQIFAD
GTVPFDDVAEAERVLRELKVEVSK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggttgaagccatttcgggtgttcgtgtgcttgaggccgccggttcgcgtgct
atcgacgttcgcggcgtgcagtacgactcgcggcgcgtgacggcaggggatgtgttcgtc
gcgatgaagggcggatcgagcgatggcaatcgctttatcgacacggctatgcgacagggc
gcagcagcgatcattacagactcggcagagacgtttgcagcgcttcgtgaacgtcagccg
gagttggctgtggcgctggtcgagcatggccgccgggcgcttgctgaagtcagcgcggct
gtctttggcagaccagagcagacgctgaagctgagtgctgtgacaggtacgaacggcaag
acgacgacggcgtttctgttggagcagatgctgcgcagtgttggccgcaagagcgtgctg
atgggtacgatcgagacgcatatcggcgatcaggttcgcgagagcgaacatacgacgccg
gagagtcgagatgtgctcgcggtgtttgcagaaggcgtgcgtgccggttgcaccgaagtc
gtaatggagatgagttcgcatgcgctggagcaggagcgggtgtgggggctgccggtggat
gtcgcgatctttacgaacctgacgcaggaccatctggactatcacggcacgatggaggcg
tactttcaggcaaaggcgcggatctttgcaggggtaggagcgctgccgccgcgtgtggcg
gtgatcaacctcgacagcgagtacggcgatgagatgtgtcatgagtttcgcggtgccact
ctgatgacctatggcatgggggagttcgggaactaccgggcggagaacgtaagtcttgcc
ctgggagatacgcgtttcgactttgtaactcctgaaggacggattgcgatgcactcgccg
ttgagcgggcgtgtgaacgtggagaatctgctggcggcctcgtgtgcggcgttggccaga
ggcttgacgttggagcaggtggcgcatgccgctgagatgttgcaccaggtgccgggacga
tttcaggtggtgcccggatcgaaggcagccggcttcttcgtggtggtggactacgcccac
accgatgatgcgctgcgaaatttgattgccctggcccgtgagtcggtggttggccatggc
gggcgcgcgattacgctgtttggctgcggtggcgatcgcgataagacgaagcgtccgaag
atggggcgtgctgcgggagaagacagcgatctggtcgtggtgaccagcgacaatccgcgc
agtgaagagccgatgacgattatcaacgaggcattgctgggggttcgcgagacgcagacg
accttcatcgtggaagaagaccggcgcgcggcgattgaggtggcgattcgttcggcaaag
ccgggagatattgtgctgctcgcgggcaaggggcatgagaaggtgcagatctttgccgat
ggcactgtgccgtttgatgatgttgcggaagcggagcgggtgctgcgcgaattaaaggtt
gaggtaagcaagtga

DBGET integrated database retrieval system