KEGG   Granulicella mallensis: AciX8_4163Help
Entry
AciX8_4163        CDS       T01664                                 

Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
gma  Granulicella mallensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AciX8_4163
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AciX8_4163
Enzymes [BR:gma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AciX8_4163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5313244..5314680)
Genome map
AA seq 478 aa AA seqDB search
MRIFQAISPSFPRIAASSVLLLGALALPAYASNPKVTQWLTTPDRTSLLAKQPGQLRFKD
ASGAGPTIEVDDAKTFQTMDGFGFALTGGSAELIMRMTPKARTSLLHELFGVKGNAIGVS
YLRVSIGSSDMNDHVFTYDDLPQGEKDLSLEHFNLGPDLKDVIPVLKEILAINPRISILA
SPWSAPSWMKTNDDPKGGSLKPEYYEVYSRYLVKYIEAMRSQGITIAAITIQNEPLNPKN
TPSMYMSSEEQAQFIRQAFGPQLRKSNLATKIVLYDHNCDKPEYATSILKDPEASQYVDG
SGFHLYGGTIDAMTTVHDAAPQKNLYFTEQMIIDQKSDPTLQIAKPVSRVVIGATENWSR
NVLLWNLAADPQFGPHTSNGGCPVCEGAITLDGDKVTRNLAFYTVGQASKFIPVGSTRIA
SSPASAEVPPHVAFRTPAGKHVLIVANPGAEAKTFNIRFEGKAVSTSLGANAAATYTW
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatctttcaagctatttccccctcttttccccggattgcggccagttcggtcctt
ttgttgggagcgcttgctctgcctgcttatgcctccaatccaaaggtcacgcaatggctg
acgacgccggatcgcacctctctgctggcgaaacagccagggcaactccgtttcaaagat
gcctccggagcgggacccaccattgaggtggacgatgcaaagacctttcagacgatggat
ggttttggtttcgctctgacgggaggaagcgccgagttgatcatgcgcatgaccccgaag
gcgcgcaccagccttctccatgaactctttggcgtgaaggggaatgcgattggagtgagt
tatctccgggtgagcatcggatcctccgacatgaacgaccacgtctttacgtatgacgat
ctgccgcagggggagaaggatctgtccctggagcacttcaatctggggcccgacttgaag
gacgtcatccccgttctgaaggagattctcgcgatcaaccccaggatctctatccttgct
tcgccctggagcgctccttcctggatgaagacgaatgacgatccgaaaggcggctctctc
aagccggagtactatgaggtttatagccgctacctggtgaagtacatcgaggcgatgcgc
tcccagggaattacgatcgctgcgatcacgatccagaatgaaccgttgaatccaaagaac
acgccgagtatgtacatgtcgtctgaagagcaggcgcagttcatccggcaggccttcggt
ccgcagcttcgcaaaagcaacctagccacgaagatcgtgctctatgaccacaactgcgac
aagccggagtacgccacctcgatcctcaaggacccggaggccagccagtacgtcgatggt
tcgggctttcatctttatggcggcaccatcgatgcgatgacgacggtccacgacgcggct
ccgcaaaagaacctctactttacagagcagatgatcatcgatcagaagtctgacccaact
ctccagattgccaagcctgtgtcacgtgttgtgatcggcgcgactgaaaactggagccgc
aatgtcctgctctggaacctagcggccgatccgcagtttggtccacacaccagcaatggc
ggttgcccggtctgcgaaggcgctatcaccctcgatggcgacaaggtgacgagaaatctg
gctttctatacggtcgggcaggcgtcgaagtttattccggtgggttctactcggatcgct
tccagtcctgcttctgccgaggttcctccgcatgttgcctttcgtactccggcggggaag
catgtgttgatcgttgccaatccgggagcggaggccaaaaccttcaatatccgttttgag
ggcaaagccgttagtaccagcctcggagcgaacgcggccgcgacgtatacgtggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system