KEGG   Granulicella mallensis: AciX8_4349Help
Entry
AciX8_4349        CDS       T01664                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gma  Granulicella mallensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gma03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5555871..5556758
Genome map
AA seq 295 aa AA seqDB search
MPELPEVETVANGVDARVRGQRIVSVWTSGKPQTFKSPETEIVETLTGTKIEKVRRVGKT
IVMDLVRGGAAGKQIPSGNDNKKSKDKDKDAGTKDTAQFLVHLGMTGRLLVSQAEVPLPP
HTHAVLALADGREVRFVDPRRFGRLSVVTTEEGYTGPGVEPTTVSEEEFAGLFKGRKLAI
KAALLNQSILHGVGNIYADESLFRAGIRPRKQAGKLTRAELGRLHEALQQVLAHAIKLGG
SSVSDYVDADGVRGFFQLEHKVYSRAGEDCKDCGAGLKKIVVGGRTTVYCPTCQR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccggagttacctgaggtcgaaaccgttgccaatggggtcgatgcccgcgtccgtgga
cagcgaatcgtaagtgtgtggacgagtgggaagccccagacgttcaagtcgccagagacg
gagatcgtcgagacgctgactggaacaaagattgagaaagtacggcgggtcggcaagacg
attgtgatggacctggtgcgtggtggcgctgccggaaagcagattccctccgggaatgac
aacaagaaaagcaaggacaaagacaaagacgcgggcacgaaggatacggcgcagtttcta
gttcatcttgggatgaccggacggctgctggtgtcgcaggcggaggttccgctgccgccg
catacccatgcagtgcttgcgctcgccgatggccgcgaggtgcggtttgtcgatccgcgg
cggttcgggcggctctcggtggtgactacagaagagggttacaccgggccgggtgtcgaa
cctacgaccgttagcgaagaggagtttgccgggctgttcaaggggcgcaagctggcgatc
aaagccgcgctcctgaaccagtcgatcctgcatggggtggggaatatctatgcggatgag
agcctgtttcgcgcaggcatccggccacggaaacaggccggcaagctgacgcgggcagag
ctcggacgtctgcatgaggctttgcagcaggtactggcgcatgccatcaagctgggcgga
tcgtcggtgtcggattacgtagacgcggatggggtgcgcgggttctttcagctcgagcac
aaggtctacagccgtgcgggcgaggattgcaaagattgcggggcggggcttaagaagatt
gtcgtcggtgggcgaacaacggtgtattgcccgacgtgccagcggtaa

DBGET integrated database retrieval system