KEGG   Granulicella mallensis: AciX8_4463Help
Entry
AciX8_4463        CDS       T01664                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gma  Granulicella mallensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciX8_4463
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciX8_4463
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AciX8_4463
Enzymes [BR:gma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AciX8_4463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5692309..5693085)
Genome map
AA seq 258 aa AA seqDB search
MPITFPNKPGLVIYLTAGDPDLGTTRDMAIAAIDNGADVIELGVPFSDPLADGPVIQRAS
ERAVAKGTRLTDVLVICKEIRAARPQAGIILFSYLNPVVRLGMAAFAKAAKDAGADGVLL
TDMIVEEATEYLAAMRANDLAPVFLAAPTSPDERLKAIAENSRGFVYAISRVGITGTQAE
LASDAEQLVKRLKQFTKLPIALGFGISTPAHVQTVAGFADAAVVGSAIVGLVEKTPAAEA
PRAVGDFVRSLRKGTTGA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcccattacttttccaaacaaaccgggcctcgtgatctacctcaccgcaggcgatcct
gacctcggcacgacgcgcgacatggcgattgccgccatcgacaatggcgccgacgtcatc
gaactcggcgtgccgttcagcgacccgctggccgatggccctgtgattcagcgcgccagc
gagcgtgccgtcgccaagggcacacgcctgaccgatgtgctcgtgatctgcaaggagatt
cgtgcagcgcgaccgcaggcgggcatcatcctgttcagctatctcaacccggtcgtgcgg
ctgggcatggcagcttttgcgaaggcagcgaaggacgccggcgcggacggtgtgctgctg
accgacatgatcgtcgaagaggccaccgagtaccttgcggcgatgcgggccaacgatctc
gctcccgtctttctggccgccccgacgagccctgacgagcggctgaaggctatcgcagaa
aactcccgggggttcgtctacgcgatctcgcgcgtgggaattacgggcacgcaggccgag
cttgccagcgatgcggaacaactcgtgaagcggctgaagcagttcacgaagctgcctatc
gcgctgggattcggcatctcgacgccggcgcatgtgcagacggtcgctggctttgccgat
gctgccgttgtgggcagtgccatcgtcgggctggtggagaagaccccggcggcagaggcc
ccgcgggctgttggagactttgttcgcagcctgcggaagggaacaaccggcgcatga

DBGET integrated database retrieval system