KEGG   Granulicella mallensis: AciX8_4463Help
Entry
AciX8_4463        CDS       T01664                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gma  Granulicella mallensis
Pathway
gma00260  Glycine, serine and threonine metabolism
gma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gma01100  Metabolic pathways
gma01110  Biosynthesis of secondary metabolites
gma01130  Biosynthesis of antibiotics
gma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciX8_4463
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AciX8_4463
Enzymes [BR:gma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AciX8_4463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PRA-PH
Motif
Other DBs
NCBI-ProteinID: AEU38736
JGI: AciX8_4463
UniProt: G8NUA1
Position
complement(5692309..5693085)
Genome map
AA seq 258 aa AA seqDB search
MPITFPNKPGLVIYLTAGDPDLGTTRDMAIAAIDNGADVIELGVPFSDPLADGPVIQRAS
ERAVAKGTRLTDVLVICKEIRAARPQAGIILFSYLNPVVRLGMAAFAKAAKDAGADGVLL
TDMIVEEATEYLAAMRANDLAPVFLAAPTSPDERLKAIAENSRGFVYAISRVGITGTQAE
LASDAEQLVKRLKQFTKLPIALGFGISTPAHVQTVAGFADAAVVGSAIVGLVEKTPAAEA
PRAVGDFVRSLRKGTTGA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcccattacttttccaaacaaaccgggcctcgtgatctacctcaccgcaggcgatcct
gacctcggcacgacgcgcgacatggcgattgccgccatcgacaatggcgccgacgtcatc
gaactcggcgtgccgttcagcgacccgctggccgatggccctgtgattcagcgcgccagc
gagcgtgccgtcgccaagggcacacgcctgaccgatgtgctcgtgatctgcaaggagatt
cgtgcagcgcgaccgcaggcgggcatcatcctgttcagctatctcaacccggtcgtgcgg
ctgggcatggcagcttttgcgaaggcagcgaaggacgccggcgcggacggtgtgctgctg
accgacatgatcgtcgaagaggccaccgagtaccttgcggcgatgcgggccaacgatctc
gctcccgtctttctggccgccccgacgagccctgacgagcggctgaaggctatcgcagaa
aactcccgggggttcgtctacgcgatctcgcgcgtgggaattacgggcacgcaggccgag
cttgccagcgatgcggaacaactcgtgaagcggctgaagcagttcacgaagctgcctatc
gcgctgggattcggcatctcgacgccggcgcatgtgcagacggtcgctggctttgccgat
gctgccgttgtgggcagtgccatcgtcgggctggtggagaagaccccggcggcagaggcc
ccgcgggctgttggagactttgttcgcagcctgcggaagggaacaaccggcgcatga

DBGET integrated database retrieval system