KEGG   Granulicella mallensis: AciX8_4463Help
Entry
AciX8_4463        CDS       T01664                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gma  Granulicella mallensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciX8_4463
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciX8_4463
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AciX8_4463
Enzymes [BR:gma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AciX8_4463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5692309..5693085)
Genome map
AA seq 258 aa AA seqDB search
MPITFPNKPGLVIYLTAGDPDLGTTRDMAIAAIDNGADVIELGVPFSDPLADGPVIQRAS
ERAVAKGTRLTDVLVICKEIRAARPQAGIILFSYLNPVVRLGMAAFAKAAKDAGADGVLL
TDMIVEEATEYLAAMRANDLAPVFLAAPTSPDERLKAIAENSRGFVYAISRVGITGTQAE
LASDAEQLVKRLKQFTKLPIALGFGISTPAHVQTVAGFADAAVVGSAIVGLVEKTPAAEA
PRAVGDFVRSLRKGTTGA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcccattacttttccaaacaaaccgggcctcgtgatctacctcaccgcaggcgatcct
gacctcggcacgacgcgcgacatggcgattgccgccatcgacaatggcgccgacgtcatc
gaactcggcgtgccgttcagcgacccgctggccgatggccctgtgattcagcgcgccagc
gagcgtgccgtcgccaagggcacacgcctgaccgatgtgctcgtgatctgcaaggagatt
cgtgcagcgcgaccgcaggcgggcatcatcctgttcagctatctcaacccggtcgtgcgg
ctgggcatggcagcttttgcgaaggcagcgaaggacgccggcgcggacggtgtgctgctg
accgacatgatcgtcgaagaggccaccgagtaccttgcggcgatgcgggccaacgatctc
gctcccgtctttctggccgccccgacgagccctgacgagcggctgaaggctatcgcagaa
aactcccgggggttcgtctacgcgatctcgcgcgtgggaattacgggcacgcaggccgag
cttgccagcgatgcggaacaactcgtgaagcggctgaagcagttcacgaagctgcctatc
gcgctgggattcggcatctcgacgccggcgcatgtgcagacggtcgctggctttgccgat
gctgccgttgtgggcagtgccatcgtcgggctggtggagaagaccccggcggcagaggcc
ccgcgggctgttggagactttgttcgcagcctgcggaagggaacaaccggcgcatga

DBGET integrated database retrieval system