KEGG   Granulicella mallensis: AciX8_4464Help
Entry
AciX8_4464        CDS       T01664                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gma  Granulicella mallensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciX8_4464
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciX8_4464
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AciX8_4464
Enzymes [BR:gma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AciX8_4464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5693088..5694347)
Genome map
AA seq 419 aa AA seqDB search
MSSTAIPTITSAAPVSATPGRFGIYGGRYVPETLMAALLELDHAYEQAQADAAFHAELDG
LLKDYVGRPTPLYFAKRLTETLGGAKIYLKREDLLHTGAHKINNALGQALLARRMGKQRI
IAETGAGQHGVATATVCALFGLECVVYMGEEDMRRQELNVFRMRLLGAEVRGVASGSATL
KDAINEAMRDWVTNVRTTFYILGSALGSHPYPTMVRDFHRVISKESKRQILEHEGRLPDA
IVACVGGGSNAIGAFYEYIPEPNVALIGVEAGGRGTALGEHAARFQKIGGGIPGVLQGTY
SYVLQDDAGQVATTHSVSAGLDYASVGPEHAMLHDSGRATYTSATDAEALNAVSVLSRTE
GIIPALESAHAVAEAIKLAPKMGKDKILMVNVSGRGDKDIGIMTREMNLSGATAQKVSA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaccgcaatacccacgattacctctgcagcgccggtgagcgcgactcccgga
cgcttcggcatctacggcggccgctatgtgccggagaccctgatggccgcgctactcgag
ctcgaccatgcgtacgagcaggcccaggctgatgctgcgtttcatgcagagctcgatggc
ctgctgaaggactacgtcggccgtcctacgccgctgtacttcgccaagcggcttacagag
accctgggtggagcgaagatctacctgaagcgagaagacctgctgcacaccggcgcgcac
aagatcaacaacgcgctcggccaggccctgttggcgcggcgcatgggcaagcagcgcatc
atcgccgagaccggcgcgggccagcacggcgtcgccacagctacggtgtgcgcgctcttc
ggcctggagtgcgtcgtctacatgggcgaggaagacatgcggagacaggagctgaacgtc
ttccgcatgcggctgctgggcgcggaggtgcgcggcgtggcctcgggctcggcgacgctg
aaggacgcgatcaacgaggccatgcgcgactgggttacaaatgtgcggacgacgttctac
atcctcggctcggcactgggctcgcacccttatccgacgatggtgcgcgacttccatcgc
gtcatcagcaaggagagcaagcggcagattctggagcacgaaggccgtctgccggatgct
atcgtcgcctgcgtcggcggcggctcgaacgcgatcggagcgttctacgagtacatcccg
gagccgaacgttgcgctgatcggcgtagaggcgggtggacgcggcaccgcactcggcgag
catgcggcacgcttccagaagatcggcggcggcatccccggcgtactgcagggcacctac
agctatgtgctgcaggacgacgccggccaggttgcgacgacgcactcggtgtcggcaggc
ctggactacgccagcgtcggcccggagcacgcgatgctgcatgactcgggccgcgcgact
tacaccagcgctactgatgccgaagccttgaacgcggtgagtgtactgagccgcacggag
ggaatcatccccgcactggagtcggctcatgctgtggccgaggccatcaagcttgcgccg
aagatgggcaaggacaagatcctgatggtgaatgtgagcggtcgtggagacaaggatatt
gggatcatgacgcgcgagatgaacttgagcggcgctacggcgcagaaggtgagcgcgtag

DBGET integrated database retrieval system