KEGG   Granulicella mallensis: AciX8_4692Help
Entry
AciX8_4692        CDS       T01664                                 

Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gma  Granulicella mallensis
Pathway
gma00900  Terpenoid backbone biosynthesis
gma01100  Metabolic pathways
gma01110  Biosynthesis of secondary metabolites
gma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AciX8_4692
Enzymes [BR:gma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AciX8_4692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEU38962
JGI: AciX8_4692
UniProt: G8NXG7
Position
complement(5952827..5953873)
Genome map
AA seq 348 aa AA seqDB search
MSTRVRSFSKINLGLAVGPARPDGFHGLATMYQTLALHDFVTVEARAAAVTKITLTSNHP
GVPRTETRNAEKNTAFAMVAGALTRMGITAEVTIDIQKRLPVQGGMGAGSANAVAALLGL
ERELGRALPGSERLKLAAEVGSDVPLFLLGGSVLGLGRGEEVYPLPDTPAIPCVVAIPSV
GVSTAQAFRDLDAKSEVREASSASTLTFQQPLDRLSELSRVLAAIWTIDGVESGPSGIAR
PGFPDKQGNLAENPLLALVRTGIENDFEEVAFSQHPSLRSTKRDLMGSDSGGSALYAALS
GSGSALFGLYESQADARAAQQRVQQSGTQAILTETLPRSAYWDTMFAE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccacacgcgtgcgctccttttccaagatcaacctcgggctggcggtcggcccggcg
cggccggacggctttcatggtctcgcgacgatgtatcagacgctcgcgctgcatgatttt
gtgacggtcgaggctcgggcggcggcggtgacgaaaattacgctcacctcgaaccatccg
ggggttccgcggactgagacacggaacgcggaaaagaacacggcctttgcgatggtggcc
ggtgccttgacccggatggggatcacggcggaagtgacgatcgacatccagaagcgcctg
ccggtgcagggaggcatgggcgcgggatcggccaatgccgtcgccgccctgctgggattg
gaacgcgagcttggccgggcgttgcccggatcggagcggctgaagctggcggccgaggtc
gggtcggacgtgccgctgtttctgctaggagggtcggtcctggggctggggcgtggcgaa
gaggtttatcctctgccagatacgccggcgatcccctgtgtcgtggcgattccgtcagta
ggggtttcgaccgcacaggcgttccgggacctggatgcgaagagcgaggttcgagaggca
agttccgcctctacgttgacttttcaacagcccctcgatagactaagtgagttgagccgc
gttctggctgccatctggacaatagatggcgtcgaatctggcccctccggtattgctcgc
cccggttttccggacaagcagggtaatctggccgagaacccacttctcgcgcttgtccgc
accgggatcgaaaacgacttcgaagaagtagcgttttcacagcatccctccttgcgttca
accaagcgtgatttgatgggttccgattccggcggcagcgcgctgtatgcggcgttgtcg
ggttcgggttcggcgttgtttggactctacgagtctcaggcagacgcacgcgccgctcaa
cagcgtgtccagcaatccggcacgcaggctatcctcacggagaccctgcctcgttcggct
tattgggatacgatgttcgcagagtag

DBGET integrated database retrieval system