KEGG   Granulicella mallensis: AciX8_4762Help
Entry
AciX8_4762        CDS       T01664                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
gma  Granulicella mallensis
Pathway
gma00625  Chloroalkane and chloroalkene degradation
gma00680  Methane metabolism
gma01100  Metabolic pathways
gma01120  Microbial metabolism in diverse environments
gma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    AciX8_4762
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AciX8_4762
Enzymes [BR:gma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AciX8_4762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Urocanase adh_short
Motif
Other DBs
NCBI-ProteinID: AEU39031
JGI: AciX8_4762
UniProt: G8NXN6
Position
complement(6047826..6049016)
Genome map
AA seq 396 aa AA seqDB search
MAENRGVVYLGQNKVEVQSIDFPKMQNPAGKKIEHAVILKVVSTNICGSDQHMVRGRTTA
PTGMVLGHEITGEVIELGSDVEYIKKGDLVTVPFNVACGRCRTCRMQETGVCLNVNPGRA
GGAFGYVDMGGWVGGQAEYVMVPYADFNLIPFPDKEQAMSKIKDLTMLSDILPTGFHGAV
NAGVGVGSIVYVAGAGPVGLATAASAHVLGAAVVMIGDMNKERLAHAESMGYVPLDLTTS
DNLTDLIEKAIGQREVDASIDAVGFEAKAQGKDGEEAPATVLNSLMTITRAAGSIGIPGL
YVTEDPGAHDEASKTGNLKMRFGLGWAKSHRFYTGQTPVLKYNRQLMQAILHDRLPIGKI
VNATVIPLSEAAQGYADFDKGAAKKFVLDPHGMLGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatcgcggcgttgtttatctaggacagaacaaggtggaagtgcagtcgatt
gacttcccaaagatgcagaatccagcaggcaagaagattgagcatgccgtgatcctgaag
gtggtttcgaccaacatctgcggatctgaccagcatatggtgcgagggcgtacgactgct
ccgactgggatggtgcttggccatgagattaccggagaggtgatcgagcttggatcggac
gtcgagtacatcaagaagggtgacctggtgacggtaccgttcaacgttgcttgcggacgt
tgccggacttgcagaatgcaggagacaggcgtgtgtctgaacgtcaatcccggccgcgca
ggcggcgcgtttgggtatgtcgatatgggcggctgggttggtgggcaggcggagtatgtg
atggtgccctacgccgacttcaacctgatccctttccccgacaaagaacaagcgatgtcg
aagatcaaggacctgacgatgctttcggacattctgccgaccggctttcacggtgcggtg
aatgcaggtgtcggtgtcggatcgatcgtgtatgtggccggagctggccccgtaggtttg
gcgacggcggcttccgcacatgtgctgggcgcggcagtcgtgatgattggagacatgaac
aaggagcggttggcacatgccgagagtatgggctatgtaccgcttgatctgacgacgagc
gataacctgaccgacttgattgagaaggcgatcggacagcgggaggttgatgcttcgatt
gatgcggttggctttgaagcaaaggcgcagggtaaggatggtgaagaggctccggcaact
gtgctgaactcgctgatgacgatcacgagggctgctgggtcaattggcatccccggactg
tatgtcaccgaggatccgggtgcgcatgatgaagcgagcaagaccggaaatctgaagatg
cggttcggcctgggctgggcgaagtcgcaccggttctatacggggcagactcctgtactg
aagtacaaccgccagttgatgcaggccattcttcatgaccggctgcctatcggcaagatt
gtaaacgcaaccgttattcctctgagtgaagctgctcagggctatgcggactttgacaag
ggtgcagcaaagaagttcgtgcttgatcctcatggcatgctgggggcttag

DBGET integrated database retrieval system