KEGG   Granulicella mallensis: AciX8_4853Help
Entry
AciX8_4853        CDS       T01664                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gma  Granulicella mallensis
Pathway
gma00020  Citrate cycle (TCA cycle)
gma00310  Lysine degradation
gma01100  Metabolic pathways
gma01110  Biosynthesis of secondary metabolites
gma01120  Microbial metabolism in diverse environments
gma01130  Biosynthesis of antibiotics
gma01200  Carbon metabolism
Module
gma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciX8_4853
  Amino acid metabolism
   00310 Lysine degradation
    AciX8_4853
Enzymes [BR:gma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AciX8_4853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C
Motif
Other DBs
NCBI-ProteinID: AEU39122
JGI: AciX8_4853
UniProt: G8NZK2
Position
6169849..6171498
Genome map
AA seq 549 aa AA seqDB search
MPTEVVMPQMGESITEGTLTKWLKKPGDTVARDEPLFEISTDKVDAEIPSPVAGTLGEIK
VQEGATVSINTVVCTVEEGGAAAAPNTASAPKKEDTVTPAAVATAAKDVAAAAEATAHAA
AAPAAAGPGTEVLMPQMGESITEGTITKWLKKIGDTVQRDEPIFEISTDKVDAEIPSPVA
GILTAIKVEEGATVTINTVVAVIGGGAAPAAKAPAAAAPTPAAASAPAATPAPVAASASA
GEGLRSSPLVRKIASENNVNLSQVPGTGASGRITKQDILGHLEGGAPAAQPVAAAPVAAP
TPASKPAAPAAPQPQPGELVPMTKMRAIIAKRMVESKATSAHVHTVFKVDMTRIVKLREK
EKNKYEQRNGVKLTYMPFITRAAVQALRKHPIVNSTTQGEAILYNKNINIGIAVALEWGL
IVPVIKQSEEKSFLGIARSIVDLADRARSKKLAPDDVAGGTFTLTNSGIFGEQFGTPIIA
QPQSAILGIGGLNKEAVVLTDKDGQDTIAIRSIQRFTLGFDHRTIDGSDAGKFMTDFKSY
LENWTEEIG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgaagtagtcatgccccagatgggcgaatccatcaccgaaggcaccctcacc
aaatggctcaaaaagcccggcgataccgtcgcgcgcgatgaaccgctctttgagatctcc
accgacaaggtcgatgccgagatcccctcgcccgtcgccggaacactgggcgagattaag
gtccaggaaggcgcgaccgtcagcatcaacacggtcgtctgcacggtcgaagagggcggc
gcagccgctgctccaaacaccgcttcggctccgaagaaggaagatacggtgacccctgct
gccgttgctaccgcagcgaaggacgtagccgcagccgctgaggccactgctcacgcagca
gcagcgcctgccgcagccggtcctggcacagaggttctgatgccgcagatgggcgagtcc
atcaccgagggcaccatcaccaagtggctcaagaagatcggcgacaccgtccagcgcgac
gagcccatcttcgagatctccaccgacaaggttgacgccgagatcccttcgcccgtcgcc
ggaatactcaccgcaatcaaggtggaagagggcgcgaccgtcaccatcaacaccgtggtc
gccgtcatcggcggcggagccgcgccggcagccaaggcaccggcagccgctgctcccacc
cccgctgcagcttctgcccccgcagccacacctgctcctgtcgcagcttccgcctctgcc
ggagaaggtctgcgctcctcgccgctggtacgcaagatcgcctcggagaacaatgtcaat
ctctcccaggtcccgggcaccggagcttccggccgcatcaccaagcaggacattctgggc
cacctcgaaggcggcgcacccgctgcccagcctgtagctgcagcacctgttgccgctcca
acaccggcctcgaagcctgcggcacccgctgcacctcagccgcagcccggcgagctcgtc
cccatgacaaagatgcgcgccatcatcgccaagcgcatggtcgagtccaaggccaccagc
gcgcacgtccacaccgtcttcaaggtggacatgacccgcatcgtgaagctgcgcgagaag
gaaaagaacaagtacgagcagcgcaacggcgtgaagctgacctacatgccgttcatcacc
cgcgcggccgtgcaggcgctacgcaagcaccccatcgtcaactccacgacgcagggcgaa
gcgatcctctacaacaagaacatcaacatcggcatcgcggtagcgctggagtggggcctg
atcgttccggtcatcaagcagtcggaggagaagagcttcctcggcatcgcccgttccatc
gtcgatctcgccgaccgcgcccgttcgaagaagctggctccggacgatgtggctggcggc
accttcacgctgaccaactcgggcatcttcggcgagcagttcggtacgccgatcattgcg
cagccgcagtcggccatcctcggcatcggcggcctgaacaaggaagctgtcgtgcttacc
gacaaggacggccaggacactatcgccatccgctcgatccagcgcttcaccctcggcttc
gaccatcggacgatcgatggctcggacgcgggcaagttcatgacggacttcaagtcctat
ctcgagaactggaccgaagagattgggtaa

DBGET integrated database retrieval system