KEGG   Granulicella mallensis: AciX8_4853Help
Entry
AciX8_4853        CDS       T01664                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gma  Granulicella mallensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciX8_4853
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciX8_4853
  Amino acid metabolism
   00310 Lysine degradation
    AciX8_4853
Enzymes [BR:gma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AciX8_4853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6169849..6171498
Genome map
AA seq 549 aa AA seqDB search
MPTEVVMPQMGESITEGTLTKWLKKPGDTVARDEPLFEISTDKVDAEIPSPVAGTLGEIK
VQEGATVSINTVVCTVEEGGAAAAPNTASAPKKEDTVTPAAVATAAKDVAAAAEATAHAA
AAPAAAGPGTEVLMPQMGESITEGTITKWLKKIGDTVQRDEPIFEISTDKVDAEIPSPVA
GILTAIKVEEGATVTINTVVAVIGGGAAPAAKAPAAAAPTPAAASAPAATPAPVAASASA
GEGLRSSPLVRKIASENNVNLSQVPGTGASGRITKQDILGHLEGGAPAAQPVAAAPVAAP
TPASKPAAPAAPQPQPGELVPMTKMRAIIAKRMVESKATSAHVHTVFKVDMTRIVKLREK
EKNKYEQRNGVKLTYMPFITRAAVQALRKHPIVNSTTQGEAILYNKNINIGIAVALEWGL
IVPVIKQSEEKSFLGIARSIVDLADRARSKKLAPDDVAGGTFTLTNSGIFGEQFGTPIIA
QPQSAILGIGGLNKEAVVLTDKDGQDTIAIRSIQRFTLGFDHRTIDGSDAGKFMTDFKSY
LENWTEEIG
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgaagtagtcatgccccagatgggcgaatccatcaccgaaggcaccctcacc
aaatggctcaaaaagcccggcgataccgtcgcgcgcgatgaaccgctctttgagatctcc
accgacaaggtcgatgccgagatcccctcgcccgtcgccggaacactgggcgagattaag
gtccaggaaggcgcgaccgtcagcatcaacacggtcgtctgcacggtcgaagagggcggc
gcagccgctgctccaaacaccgcttcggctccgaagaaggaagatacggtgacccctgct
gccgttgctaccgcagcgaaggacgtagccgcagccgctgaggccactgctcacgcagca
gcagcgcctgccgcagccggtcctggcacagaggttctgatgccgcagatgggcgagtcc
atcaccgagggcaccatcaccaagtggctcaagaagatcggcgacaccgtccagcgcgac
gagcccatcttcgagatctccaccgacaaggttgacgccgagatcccttcgcccgtcgcc
ggaatactcaccgcaatcaaggtggaagagggcgcgaccgtcaccatcaacaccgtggtc
gccgtcatcggcggcggagccgcgccggcagccaaggcaccggcagccgctgctcccacc
cccgctgcagcttctgcccccgcagccacacctgctcctgtcgcagcttccgcctctgcc
ggagaaggtctgcgctcctcgccgctggtacgcaagatcgcctcggagaacaatgtcaat
ctctcccaggtcccgggcaccggagcttccggccgcatcaccaagcaggacattctgggc
cacctcgaaggcggcgcacccgctgcccagcctgtagctgcagcacctgttgccgctcca
acaccggcctcgaagcctgcggcacccgctgcacctcagccgcagcccggcgagctcgtc
cccatgacaaagatgcgcgccatcatcgccaagcgcatggtcgagtccaaggccaccagc
gcgcacgtccacaccgtcttcaaggtggacatgacccgcatcgtgaagctgcgcgagaag
gaaaagaacaagtacgagcagcgcaacggcgtgaagctgacctacatgccgttcatcacc
cgcgcggccgtgcaggcgctacgcaagcaccccatcgtcaactccacgacgcagggcgaa
gcgatcctctacaacaagaacatcaacatcggcatcgcggtagcgctggagtggggcctg
atcgttccggtcatcaagcagtcggaggagaagagcttcctcggcatcgcccgttccatc
gtcgatctcgccgaccgcgcccgttcgaagaagctggctccggacgatgtggctggcggc
accttcacgctgaccaactcgggcatcttcggcgagcagttcggtacgccgatcattgcg
cagccgcagtcggccatcctcggcatcggcggcctgaacaaggaagctgtcgtgcttacc
gacaaggacggccaggacactatcgccatccgctcgatccagcgcttcaccctcggcttc
gaccatcggacgatcgatggctcggacgcgggcaagttcatgacggacttcaagtcctat
ctcgagaactggaccgaagagattgggtaa

DBGET integrated database retrieval system