KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0014Help
Entry
GY4MC1_0014       CDS       T01348                                 

Definition
(GenBank) deoxynucleoside kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00230  Purine metabolism
gmc00240  Pyrimidine metabolism
gmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GY4MC1_0014
   00240 Pyrimidine metabolism
    GY4MC1_0014
Enzymes [BR:gmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     GY4MC1_0014
    2.7.1.76  2'-deoxyadenosine kinase
     GY4MC1_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Thymidylate_kin SKI AAA_28 Cytidylate_kin2 TsaE AAA_33 RsgA_GTPase Cytidylate_kin ABC_tran AAA_15 RNA_helicase AAA_29 AAA_22 ParA AAA CbiA MMR_HSR1 PRK NB-ARC AAA_14 ATP_bind_1 AAA_16 AAA_5
Motif
Other DBs
NCBI-ProteinID: ADP72870
UniProt: A0A0F6BHG9
Position
complement(23540..24208)
Genome map
AA seq 222 aa AA seqDB search
MNLREKYRIPDNAIITIAGTVGVGKSTMTKALAKALNFRTSLEKVDTNPYLDKFYADFER
WSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDAHIFAKMHFENGTMTAVDYETYTS
LFQAMVMTPYFPHPDLLIYLEGSFEEVIKRIRERGRPMEQKTPVSYWKEMYERYEKWINE
FNACPVLRVNINEYDIIEDEQSIEPIIKKAATIIHEYYHIKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacgtgaaaaatatcgtattccagataacgccatcattacgattgccggaaca
gttggcgtcggtaaatcaaccatgacaaaagcattagcaaaagcgttaaatttccgcact
tccctagaaaaagtcgatacgaatccatatttagacaagttttatgctgattttgaacgg
tggagtttccatttgcaaatctattttcttgccgagcggtttaaagaacaaaaacgaatg
tttgaatatggcggcggctttgttcaagatcgttcaatttacgaagacgcgcatattttc
gcaaaaatgcattttgaaaatggaacaatgacagcagtagattacgaaacatatacgagc
ttatttcaagcaatggtaatgacaccatacttcccgcatcctgatttgcttatttatttg
gaaggaagttttgaagaagtgataaaacgtatccgtgagcgcgggcgcccaatggaacaa
aaaacaccggtatcatattggaaagaaatgtatgaacgttacgaaaaatggattaatgaa
tttaacgcttgtccggttcttcgcgtaaacattaacgaatatgatattatcgaagacgag
cagtccatcgaaccaatcattaaaaaagcggcaacgattattcatgaatattatcacata
aaaaaataa

DBGET integrated database retrieval system