KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0046Help
Entry
GY4MC1_0046       CDS       T01348                                 

Definition
UDP-N-acetylglucosamine pyrophosphorylase
Orthology
K04042  
bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GY4MC1_0046
Enzymes [BR:gmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     GY4MC1_0046
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     GY4MC1_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
55887..57266
Genome map
AA seq 459 aa AA seqDB search
MVKRYAVILAAGQGTRMKSKQYKVLHPVCGKPMVQHVVDQVLQLGIEKLITVVGFGAEQV
KMQLGDQSEYAFQQEQLGTAHAVMQAASHLHGKDGVTLVVCGDTPLITAETMQALLDHHL
ATKAKATVLTAIADNPAGYGRIVRDSHGNVAKIVEHKDASEQERAIKEINTGTYCFDNKS
LFEALTHVSNNNVQGEYYLTDVIEILKSNGGIISAYEAPSFEETIGVNDRAALAEAEKIM
RARICRKHMLNGVTIIDPAHTYISAEAQIGRDTVIYPGTVIEGKTVIGEDCIIGPNSEIK
DCLIGNGTTIRHSVAHDSEIGNDVTIGPFAHIRPLSKIADEVRIGNFVEVKKSVFGKGSK
ASHLSYIGDAEIGADVNLGCGSITVNYDGKNKHMTKIEDGAFIGCNVNLIAPVTVGKGAY
VAAGSTITDDVPANALSIARARQVNKENYVDRLSIKKNS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacgatatgcggtcatattggcggccggacagggaacaaggatgaaatcgaag
caatacaaagtattgcaccctgtttgcggtaagccgatggtccagcatgtggtggaccaa
gttttgcagctaggaatcgaaaagcttattaccgttgtaggctttggagcagagcaagta
aaaatgcagcttggcgaccaaagcgaatatgctttccagcaggaacaactgggaacagcg
cacgcagttatgcaagcagcctctcatttgcacggaaaagatggagtaacgctcgttgta
tgcggagacacaccgttaatcactgcggaaacgatgcaagcattgcttgatcatcatctt
gcgacaaaggcaaaagcgacggttttgacggcaattgcggataatcctgccggatatggc
cgcattgttcgcgattctcatggaaatgtcgcaaaaattgtcgaacacaaagatgcaagc
gaacaggaacgcgccatcaaagaaattaacacgggaacatattgctttgacaacaagtct
ttatttgaagcgcttacacatgtatcgaacaataatgtgcaaggggaatattatttaacg
gatgtcattgaaattttaaaatccaatggcggcatcatttccgcgtacgaagccccatct
tttgaagaaacgatcggggtgaatgaccgcgcggctctcgccgaagcggaaaaaattatg
cgcgcgcggatttgccgcaaacatatgctgaacggggtcacgattattgatcctgctcat
acgtatatatcggcagaggcgcaaatcggccgcgataccgtgatttatcccgggactgtt
attgaagggaaaacagtgattggcgaagattgcattatcgggccaaattcagaaattaaa
gactgtctgattggaaacggcaccacgattcgccactctgtcgcgcacgatagcgaaatt
ggcaacgatgttacgatcgggccgtttgcccatatccgcccgttgtccaaaatcgcggat
gaagttcgcatcggtaattttgttgaagtgaaaaagtcggtgtttggcaaaggaagtaaa
gcatcacacttaagctacatcggcgatgcggaaatcggcgcggacgtcaaccttggctgc
ggatccattaccgtaaattacgatgggaaaaataaacatatgacgaaaattgaagatgga
gcgtttatcggctgtaatgtgaatttaattgctccggtgacggttgggaaaggcgcatat
gtcgctgctggttcgacgattacggatgatgttcccgcaaatgcgctgtcaattgcccgc
gctcggcaagtaaataaagagaattatgtggatcgcctttctattaagaaaaattcgtaa

DBGET integrated database retrieval system