KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0073Help
Entry
GY4MC1_0073       CDS       T01348                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gmc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
86425..87279
Genome map
AA seq 284 aa AA seqDB search
MATTSATPFVLRCGDYELDLRKKTMVMGIVNVTPDSFSDGGRFYDLDRAVEHAKQLVADG
ADIIDIGGESTRPGAEKVSLEEELRRVIPVVKAVAQEINVPISIDTYKAEVAKQAIEAGA
HIINDVWGAKADEKMAEVAAFYDVPIILMHNRHDLQYRDLISDMISDLMESVAIVKRAGV
KDENIILDPGIGFAKTLEHNLEIMRRLDEFAKLGYPLLLGTSRKRFIGHVLDLPVDERVE
GTGATVCLGIAKGAHIVRVHDVLPIARMVKMMDAMLGKGVANDR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggctacaacaagtgcaaccccttttgtgctgcgctgcggggattacgagctggatttg
cgaaaaaaaacaatggtcatggggattgtcaacgtaacgccggattctttctctgacggc
ggacggttttatgatctcgaccgcgcggtggagcacgcaaagcaacttgttgccgatggt
gcggacattattgatattggcggggaatcgacccggccaggtgctgagaaagtatcgctt
gaggaagagctgcggcgggtaattcctgtggtgaaagcggtcgctcaagaaatcaatgtc
cctatttccattgatacgtataaagcggaagtcgccaaacaagcgatcgaagcgggagcg
cacatcattaacgatgtatggggggcaaaagcagacgagaaaatggcggaagtcgccgct
ttttatgatgttccgattattttaatgcataatcgccatgatcttcagtaccgtgattta
atttccgatatgatttctgatttaatggaaagtgtcgccatcgtaaaacgcgcaggcgtg
aaagacgaaaacattattttagatccggggatcggatttgcgaaaacattggagcataat
ctggaaattatgcgccgtttagatgaatttgccaaactaggatatccgctcttgcttggc
acgtcacggaaacggtttatcggccatgtccttgatttaccggttgatgaacgagtcgaa
gggacaggagcgaccgtatgcttgggaatcgcaaagggagctcatatcgtccgcgttcac
gatgtattgccaattgcgcgaatggtgaaaatgatggatgcaatgcttggaaaaggagtg
gcgaacgatcgataa

DBGET integrated database retrieval system