KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0152Help
Entry
GY4MC1_0152       CDS       T01348                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00220  Arginine biosynthesis
gmc00330  Arginine and proline metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01130  Biosynthesis of antibiotics
gmc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    GY4MC1_0152
   00330 Arginine and proline metabolism
    GY4MC1_0152
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GY4MC1_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADP73008
UniProt: A0A0F6BHV7
Position
165552..166472
Genome map
AA seq 306 aa AA seqDB search
MERGNSVKKVSIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERLHYEIEDLGDVSIGKM
EWSDDEGLRLNLRNLKAVAKTNEKLAEMVDDVVQRGRFPLVLGGDHSIAIGTLAGVAKHY
QNLGVIWYDAHGDLNTAETSPSGNIHGMSLAVCLGLGHPYLTKIGGYSPKVKPENVVLIG
VRSLDEGEKQLIREKGIKVYTMHEVDRLGMAAVMEETIAYLQGRTDGVHLSLDLDGLDPH
DAPGVGTPVIGGLTYRESHLAMEMLAEAQLITSAEFVEVNPILDERNKTASVAVGLMGSL
FGEKLV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggggaaacagtgtgaagaaagtatcgatcattggagtgccaatggatttaggg
cagacacgccgcggtgtggatatggggccgagcgccatgcgttatgcaggaatcatcgag
aggctggaacgccttcattatgagattgaagatttgggcgatgtttcaattggaaaaatg
gaatggtctgatgatgaagggttacggcttaatttgcgcaatttgaaagcggttgcaaaa
acaaatgaaaaattggcggagatggtggacgatgtagtccaaagaggtcgctttcctctt
gtgcttggcggcgaccatagcattgccatcgggacattagctggtgtcgcaaagcattat
caaaatttgggagttatttggtatgatgcccatggcgatttaaatacagcggaaacttct
ccgtcagggaatattcatgggatgtcgctcgctgtgtgccttggtttggggcatccatat
ttgacgaagatcggcggatacagtccaaaagtaaaaccggaaaatgttgttcttattggt
gtccgttctcttgatgaaggggaaaaacaattaatccgtgaaaaggggattaaggtatat
acgatgcatgaagtagatcgcctcggaatggcggctgtgatggaggaaacgattgcttat
ttgcaaggacggacagacggcgtgcatttatctcttgatttagatgggcttgatccgcac
gatgctccgggagtgggcacgccggttatcgggggccttacttatcgcgaaagccatttg
gcaatggaaatgcttgcagaagcgcaactaattacatcagcagaatttgtagaagtgaat
ccgattttagatgaacggaataagactgcttccgtcgcggtgggattgatggggtccctt
tttggagaaaaattagtgtag

DBGET integrated database retrieval system