KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0152Help
Entry
GY4MC1_0152       CDS       T01348                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gmc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gmc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
165552..166472
Genome map
AA seq 306 aa AA seqDB search
MERGNSVKKVSIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERLHYEIEDLGDVSIGKM
EWSDDEGLRLNLRNLKAVAKTNEKLAEMVDDVVQRGRFPLVLGGDHSIAIGTLAGVAKHY
QNLGVIWYDAHGDLNTAETSPSGNIHGMSLAVCLGLGHPYLTKIGGYSPKVKPENVVLIG
VRSLDEGEKQLIREKGIKVYTMHEVDRLGMAAVMEETIAYLQGRTDGVHLSLDLDGLDPH
DAPGVGTPVIGGLTYRESHLAMEMLAEAQLITSAEFVEVNPILDERNKTASVAVGLMGSL
FGEKLV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggggaaacagtgtgaagaaagtatcgatcattggagtgccaatggatttaggg
cagacacgccgcggtgtggatatggggccgagcgccatgcgttatgcaggaatcatcgag
aggctggaacgccttcattatgagattgaagatttgggcgatgtttcaattggaaaaatg
gaatggtctgatgatgaagggttacggcttaatttgcgcaatttgaaagcggttgcaaaa
acaaatgaaaaattggcggagatggtggacgatgtagtccaaagaggtcgctttcctctt
gtgcttggcggcgaccatagcattgccatcgggacattagctggtgtcgcaaagcattat
caaaatttgggagttatttggtatgatgcccatggcgatttaaatacagcggaaacttct
ccgtcagggaatattcatgggatgtcgctcgctgtgtgccttggtttggggcatccatat
ttgacgaagatcggcggatacagtccaaaagtaaaaccggaaaatgttgttcttattggt
gtccgttctcttgatgaaggggaaaaacaattaatccgtgaaaaggggattaaggtatat
acgatgcatgaagtagatcgcctcggaatggcggctgtgatggaggaaacgattgcttat
ttgcaaggacggacagacggcgtgcatttatctcttgatttagatgggcttgatccgcac
gatgctccgggagtgggcacgccggttatcgggggccttacttatcgcgaaagccatttg
gcaatggaaatgcttgcagaagcgcaactaattacatcagcagaatttgtagaagtgaat
ccgattttagatgaacggaataagactgcttccgtcgcggtgggattgatggggtccctt
tttggagaaaaattagtgtag

DBGET integrated database retrieval system