KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0152Help
Entry
GY4MC1_0152       CDS       T01348                                 

Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GY4MC1_0152
  Amino acid metabolism
   00220 Arginine biosynthesis
    GY4MC1_0152
   00330 Arginine and proline metabolism
    GY4MC1_0152
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GY4MC1_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
165552..166472
Genome map
AA seq 306 aa AA seqDB search
MERGNSVKKVSIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERLHYEIEDLGDVSIGKM
EWSDDEGLRLNLRNLKAVAKTNEKLAEMVDDVVQRGRFPLVLGGDHSIAIGTLAGVAKHY
QNLGVIWYDAHGDLNTAETSPSGNIHGMSLAVCLGLGHPYLTKIGGYSPKVKPENVVLIG
VRSLDEGEKQLIREKGIKVYTMHEVDRLGMAAVMEETIAYLQGRTDGVHLSLDLDGLDPH
DAPGVGTPVIGGLTYRESHLAMEMLAEAQLITSAEFVEVNPILDERNKTASVAVGLMGSL
FGEKLV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggggaaacagtgtgaagaaagtatcgatcattggagtgccaatggatttaggg
cagacacgccgcggtgtggatatggggccgagcgccatgcgttatgcaggaatcatcgag
aggctggaacgccttcattatgagattgaagatttgggcgatgtttcaattggaaaaatg
gaatggtctgatgatgaagggttacggcttaatttgcgcaatttgaaagcggttgcaaaa
acaaatgaaaaattggcggagatggtggacgatgtagtccaaagaggtcgctttcctctt
gtgcttggcggcgaccatagcattgccatcgggacattagctggtgtcgcaaagcattat
caaaatttgggagttatttggtatgatgcccatggcgatttaaatacagcggaaacttct
ccgtcagggaatattcatgggatgtcgctcgctgtgtgccttggtttggggcatccatat
ttgacgaagatcggcggatacagtccaaaagtaaaaccggaaaatgttgttcttattggt
gtccgttctcttgatgaaggggaaaaacaattaatccgtgaaaaggggattaaggtatat
acgatgcatgaagtagatcgcctcggaatggcggctgtgatggaggaaacgattgcttat
ttgcaaggacggacagacggcgtgcatttatctcttgatttagatgggcttgatccgcac
gatgctccgggagtgggcacgccggttatcgggggccttacttatcgcgaaagccatttg
gcaatggaaatgcttgcagaagcgcaactaattacatcagcagaatttgtagaagtgaat
ccgattttagatgaacggaataagactgcttccgtcgcggtgggattgatggggtccctt
tttggagaaaaattagtgtag

DBGET integrated database retrieval system