KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0193Help
Entry
GY4MC1_0193       CDS       T01348                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gmc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gmc00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:gmc00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
215287..216513
Genome map
AA seq 408 aa AA seqDB search
MPFSYVSHLYCPKCQKTYGTNKKHQLCECGSPLLVAYHLDALRADLSREIIASREPNLWR
YHELLPVENPEHIVSLGEGMTPLVPMPRLGKDMDIEQLYMKDEGVIPTGTFKARGAAVGI
SKAKELGVKKLAMPTNGNAGAAWSLYAARAGIQVTVVMPVDAPTITRNECAIAGADLYLV
NGLISDAGAIVSKAIQERNLYDASTLKEPYRIEGKKTMGLEIAEQFSWQLPDVILYPTGG
GVGLIGIYKALKELQDLGWVQGKMPRLVAVQAQNCAPIVKAWNERKRVSEFWPNSSTVAF
GINVPKALGDFLVLDALYKTDGCAIAVEDDAIINEQRNVANLEGAFICPEGAAAFVAARR
LRERGWIRRGERVVVLNTGIGLKYTHTVSIEVPILQPGDHLPERKDYS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccattcagttatgtatcccatttgtactgtccgaagtgtcaaaaaacatatggcaca
aataaaaagcatcagctatgcgagtgcggttcgccgctgcttgtcgcataccatcttgac
gcgttacgcgcagacctaagccgtgaaattattgcaagcagagagcctaacctatggcgg
taccacgaattattacccgtagaaaatcctgaacatatcgtttctttaggagaaggcatg
acgccgcttgttcctatgcctcggcttggtaaagacatggatatcgagcagttatatatg
aaggacgaaggagtaattccgacaggaacctttaaagcgagaggggcagctgttggtata
tcaaaagcaaaagaactgggagtcaaaaagttggctatgccgacaaatggaaatgcagga
gcggcgtggtcgctttatgcagctagggcagggattcaagtaactgttgtaatgccagtg
gacgctccaacgattacaaggaacgaatgtgccatcgctggagccgatctttacttggtg
aacggtttaatcagcgatgcaggggccatagtcagcaaagcaatccaggagcgaaacctg
tatgacgcctctacgcttaaagagccttaccgtattgaaggtaagaaaacgatgggattg
gagatagcagagcaattctcttggcaactccctgatgtcattttatatccgaccggggga
ggtgtcgggctgatagggatttataaggcgctgaaagaattgcaggatcttggatgggtg
caaggaaagatgccaaggctggtggctgtacaggcgcaaaattgcgctcctattgtaaaa
gcctggaatgaaaggaaacgggtatcggaattctggccaaactcttcgactgttgctttc
gggattaatgtgccgaaagctttaggggacttcctcgtattagatgctctgtataaaaca
gatgggtgcgcgattgctgtagaagacgatgccatcattaatgagcagcgaaacgttgct
aatctcgagggggcttttatttgtccggaaggggctgcggcgtttgtagctgcccgccgt
ctgcgcgagagaggatggattcgtaggggagaaagggttgtcgttcttaatacgggaatt
ggattgaaatatacgcataccgtgagtatcgaggtgccaatcctgcaaccaggtgatcat
ttacctgagaggaaagattattcttga

DBGET integrated database retrieval system