KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0397Help
Entry
GY4MC1_0397       CDS       T01348                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gmc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:gmc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
434700..435968
Genome map
AA seq 422 aa AA seqDB search
MKIERVKSRVSLRRTIESGTEEQRRAVLEIISTVRARGDEALKSYTEKFDGVRLDSLRVT
NEEIEAAYQNVSEEALRIIREAAENIRDYHERQKRESWIIAKEDGTMLGQKITPLDAVGL
YVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKNGTLPAGVLVAASELGVKEIYKVG
GAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGQVAIDMIAGPSEIVVLADETAN
VNEIAADLLSQAEHDERASAILVTPSMKLALAVASEVKKQLETLPRKAIAVSALENYGAI
YVTETLAEAVEVVNELAPEHLEVMTAEPMQLLGQIRHAGAIFLGRFSSEPVGDYFAGPNH
VLPTNGTARFSSGLSVDEFVKKSSIIFYSEPALQRNAGKIAAFARLEGLEAHARAVEERF
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcgaacgagtgaaaagccgtgtatcattgcgccgcacgattgagtcagggacg
gaagaacagcggcgtgcggtgttggagattatttccactgtgcgcgcccgcggcgatgaa
gccttgaaaagctatacggaaaaattcgatggcgtgcggctcgattcgctgcgcgtgaca
aatgaagaaatcgaagcggcgtatcaaaacgtaagcgaggaagcgcttcgcatcattcgc
gaagcggcggaaaacattcgcgattatcacgagcggcaaaagagggagtcatggatcatt
gcaaaagaagacggcacgatgctcgggcaaaaaataacgccgctcgatgcggttgggctg
tacgttccaggagggacggcggcatacccgtcatcggtgcttatgaatgtcattcctgct
caagtggcgggagtgaaacggatcgtgatcacatctccgccaaataaaaacgggacgctc
ccggccggcgtattagtcgcggccagtgaattgggcgtgaaagaaatctataaagtcggc
ggcgcgcaggcgattgccgcgctcgcatatggaacggaaacgattcgcccggtcgataaa
attttcggaccaggcaacatctatgtggcgcttgccaaacgggaagtgtttggacaagtg
gcgattgacatgattgccgggccaagcgaaatcgtcgtgctggccgatgaaacggcaaat
gtgaacgaaatcgccgctgacttgttgtcacaagctgaacatgatgagcgtgcttcggcg
attctcgtcacgccgtcgatgaaattggcgctcgcggtcgcaagcgaggtcaaaaaacag
cttgaaacgctgccgcgcaaagcgattgccgtttcggcgctcgaaaattacggagcgatt
tatgttacagaaacgcttgcggaagcggtggaagttgtcaatgaactggcgccagagcat
ttggaagtgatgacagccgaaccgatgcagcttcttggccaaatccgccacgcgggagcg
atttttttagggcgcttcagctctgagcctgtcggcgattatttcgccggcccgaaccac
gtgctgccgacgaacggcacggcccggttttcgagcggattaagcgtggatgagtttgtg
aaaaaatcgagcatcattttttacagtgaaccggcgctacaacgaaacgccggaaaaatc
gcggcattcgcaagacttgaagggcttgaggcacatgcgcgcgccgttgaggaacgtttc
aaaaaataa

DBGET integrated database retrieval system