KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0416Help
Entry
GY4MC1_0416       CDS       T01348                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GY4MC1_0416
   01230 Biosynthesis of amino acids
    GY4MC1_0416
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_0416
   00051 Fructose and mannose metabolism
    GY4MC1_0416
   00562 Inositol phosphate metabolism
    GY4MC1_0416
Enzymes [BR:gmc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GY4MC1_0416
Exosome [BR:gmc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GY4MC1_0416
  Exosomal proteins of bladder cancer cells
   GY4MC1_0416
  Exosomal proteins of melanoma cells
   GY4MC1_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
452233..452994
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLPEAVSFVEEVKRLVPPAEQVDSVICAPFLFLDRLVQNVQGSDLK
IGAQNMHFEDKGAFTGEISPVALKDIGVAYVIIGHSERREMFAETDETVNKKVHAAFKHG
LIPIVCCGETLEQRESGKTNDIVGAQVEKALAGLTAEQAKQVVIAYEPIWAIGTGKSSTA
EDANEVCGHIRSVIAKIFSPEVAEAVRIQYGGSVKPENIREFLAQEHIDGALVGGASLDP
KSFLQLVEAGQHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgaattatcgcaggaaactggaaaatgcataaaacattgccggaggcagta
agcttcgtggaagaagttaaacggcttgtgccgccggcagaacaagttgactctgtcatt
tgcgcccctttcttgtttttagaccgtcttgtccaaaatgtacaaggctctgatttaaaa
atcggtgcgcaaaacatgcattttgaagacaaaggggcgtttactggcgaaatcagcccg
gttgcgctgaaagatatcggcgtggcgtatgtcattatcggccactccgagcgccgcgaa
atgtttgcggagacggatgaaaccgtcaataaaaaagtgcatgctgcctttaagcatggg
ctgattccgatcgtctgctgcggcgaaacgctggaacagcgggaaagcggcaaaacaaat
gacatcgtcggcgcgcaagttgaaaaagcgcttgccggtttaactgcggagcaagcgaaa
caagtggtgatcgcctatgagccgatttgggcgattggcactggcaaatcatcgacggca
gaagatgccaacgaagtgtgcggccatattcgttcggtcatcgctaaaatcttttctccg
gaagtggctgaagccgtgcgcattcagtatggcggcagcgtcaaaccggaaaacatccgc
gaatttttagcgcaagaacatattgatggcgcccttgtcggcggcgcaagcctcgatccg
aaatcatttttacaattagtggaggctggacagcatgagtaa

DBGET integrated database retrieval system