KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0421Help
Entry
GY4MC1_0421       CDS       T01348                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GY4MC1_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DLH BAAT_C DUF2048 PhoPQ_related UPF0227 DUF676 TMP_2
Motif
Other DBs
NCBI-ProteinID: ADP73261
UniProt: A0A0F6BIL0
Position
457411..458151
Genome map
AA seq 246 aa AA seqDB search
MKVVPPKPFTFEAGERAVLLLHGFTGNSSDVRMLGRFLEAKGYTCHAPIYKGHGVPPEEL
VHTGPDDWWQDVINAYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPVVGIIPMCAPMYI
KSEETMYEGVLKYAREYKKREGKTPEQIEEEMEAFQKTPMKTLKALQQLIADVRERIDLI
YAPTFVVQARHDEMINPDSANIIYNGIESPVKKIKWYEESGHVITLDKEKEQLHEDIYEF
LESLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgttccaccaaaaccatttacgtttgaagcaggagaacgcgcagttttgttg
ctgcacggttttaccggaaactcgtcagatgtcagaatgttggggcgctttcttgaagca
aaaggatacacatgccatgcaccaatttataaagggcacggggtgccgccagaagagctt
gtgcacactggaccggacgattggtggcaagatgtgatcaacgcctatgaatttttaaag
aataaaggatacgaaaaaatcgcggttgccggactgtcgcttggaggcgtattttctctg
aaattgggttacactgtacctgtagtgggaattattccaatgtgcgcgccgatgtatata
aaaagcgaagaaacgatgtatgaaggtgtgctaaagtatgcgcgcgaatataaaaaacgg
gaaggaaaaacgccggaacaaattgaagaagaaatggaagcatttcaaaagacgccgatg
aaaacgttaaaagcattgcagcagcttattgcggatgtgcgtgagcgtatcgatttgatt
tatgcgccgacatttgtcgtgcaagcgcgccacgatgaaatgattaaccctgatagcgcc
aatattatttataacggtattgaatcgcctgtgaaaaaaatcaagtggtatgaagagtca
ggacacgtcattacgctggataaagaaaaagaacagctgcatgaggatatttacgagttt
ttagaatcgctggattggtaa

DBGET integrated database retrieval system