KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0421Help
Entry
GY4MC1_0421       CDS       T01348                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Brite
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GY4MC1_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
457411..458151
Genome map
AA seq 246 aa AA seqDB search
MKVVPPKPFTFEAGERAVLLLHGFTGNSSDVRMLGRFLEAKGYTCHAPIYKGHGVPPEEL
VHTGPDDWWQDVINAYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPVVGIIPMCAPMYI
KSEETMYEGVLKYAREYKKREGKTPEQIEEEMEAFQKTPMKTLKALQQLIADVRERIDLI
YAPTFVVQARHDEMINPDSANIIYNGIESPVKKIKWYEESGHVITLDKEKEQLHEDIYEF
LESLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgttccaccaaaaccatttacgtttgaagcaggagaacgcgcagttttgttg
ctgcacggttttaccggaaactcgtcagatgtcagaatgttggggcgctttcttgaagca
aaaggatacacatgccatgcaccaatttataaagggcacggggtgccgccagaagagctt
gtgcacactggaccggacgattggtggcaagatgtgatcaacgcctatgaatttttaaag
aataaaggatacgaaaaaatcgcggttgccggactgtcgcttggaggcgtattttctctg
aaattgggttacactgtacctgtagtgggaattattccaatgtgcgcgccgatgtatata
aaaagcgaagaaacgatgtatgaaggtgtgctaaagtatgcgcgcgaatataaaaaacgg
gaaggaaaaacgccggaacaaattgaagaagaaatggaagcatttcaaaagacgccgatg
aaaacgttaaaagcattgcagcagcttattgcggatgtgcgtgagcgtatcgatttgatt
tatgcgccgacatttgtcgtgcaagcgcgccacgatgaaatgattaaccctgatagcgcc
aatattatttataacggtattgaatcgcctgtgaaaaaaatcaagtggtatgaagagtca
ggacacgtcattacgctggataaagaaaaagaacagctgcatgaggatatttacgagttt
ttagaatcgctggattggtaa

DBGET integrated database retrieval system