KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0530Help
Entry
GY4MC1_0530       CDS       T01348                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GY4MC1_0530
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GY4MC1_0530
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GY4MC1_0530
Enzymes [BR:gmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GY4MC1_0530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
563229..564290
Genome map
AA seq 353 aa AA seqDB search
MTWKGLLHAYREFLPINENTPMLTLNEGNTPLIPLPRLSEKLGVELYVKVEGANPTGSFK
DRGMVMAVAKAKESGSHTIICASTGNTSASAAAYAARAGLRCIVVIPNGKIAMGKLAQAV
MYGAEIFAIEGNFDEALKMVRRLSDMAPITLVNSVNPYRIEGQKTAAFEICDQLGKAPDV
LAIPVGNAGNITAYWKGFKEYHAAKQTGLPQMRGFEAEGAAAIVRNQVIEHPETIATAIR
IGNPASWEKAVQAAAESNGKIDEVSDAEIVEAYKLLAREEGIFAEPASCASIAGVIKQRK
RNEIEKGSTVVAVLTGNGLKDPAIAMEVAEIEPTVLANDETVVFEHIQGVVHQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacatggaaaggtttgctgcacgcataccgcgaatttttgccaatcaatgaaaacacc
ccgatgcttactttgaatgaaggaaatacgccgcttattccgctgccgcggttgtcggaa
aagcttggcgttgaattatatgtcaaagtcgaaggggcaaacccgacaggatcattcaaa
gaccgcggcatggtgatggcggtcgcaaaggcgaaagaatcaggaagccatacgattatt
tgcgcttcgacaggcaacacgtccgcctccgcggcggcctacgcggcaagagcggggctg
cgctgcatagtggtgattccgaatggaaaaatcgcaatggggaaattagcgcaggcggtg
atgtacggagcggaaatttttgcgattgagggaaactttgatgaagcgttaaaaatggtg
cgccgccttagcgatatggccccaattacgcttgtcaattcggtaaatccataccgcatc
gaggggcagaaaacagcggcgtttgagatttgcgaccagcttggcaaagcgccggacgtg
cttgcgattccggtcggtaatgccgggaatattaccgcttattggaaaggatttaaagaa
tatcatgcggcaaaacaaacgggccttccgcaaatgcgcggattcgaagcggaaggagcg
gctgcgatcgtccgcaatcaagtcatcgagcatccggagacgatcgcgacagcgattcgc
atcggcaatccggcgagctgggaaaaagcggtgcaagcagcggcggagtcgaacggaaaa
attgatgaagtatctgatgcagaaattgtagaagcgtataaactgcttgcgcgggaggaa
gggatttttgccgaaccagcttcttgtgcatccattgcaggagtgatcaagcagcggaag
cggaatgaaattgaaaaaggaagcaccgttgtggccgtattaaccggaaatggcctgaaa
gatccggccattgcgatggaagtggcagaaatcgagccaaccgtgcttgcaaacgacgaa
accgtcgtgtttgaacacattcaaggagttgtccatcaatga

DBGET integrated database retrieval system