KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0709Help
Entry
GY4MC1_0709       CDS       T01348                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GY4MC1_0709
Enzymes [BR:gmc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GY4MC1_0709
Exosome [BR:gmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GY4MC1_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
709395..711326
Genome map
AA seq 643 aa AA seqDB search
MSVVPPTDLEIYLFHEGSLYKSYELFGAHVIKQNDVVGTRFCVWAPHARQVRLVGSFNDW
NGTNFNLVKVSNQGVWTIFIPENLEGHLYKYEITTSDGNVVLKADPYAFHSELRPRTASI
VYDIKGYQWNDQTWRRKKQRKRIYDQPLFIYELHFGSWKKKENGNFYTYREMADELLPYV
MEHGFTHIELLPLVEHPLDRSWGYQGTGYYSATSRYGTPHDLMHFIDRFHQAGIGIIFDW
VPGHFCKDEHGLYMFDGAPTYEYDNIQDRENGEWGTANFDLGKPEVRSFLISNALFWMEY
FHVDGFRVDAVANMLYWPNREAAQQNPHAVQFLQKLNETVFAHDPGILMIAEDSTEWPLV
TAPTYAGGLGFNYKWNMGWMNDILTYMETAPEKRKHVHNKVTFSLLYAYSENFILPFSHD
EVVHGKKSLLNKMPGTYEEKFAQLRLLYGYLLTHPGKKLLFMGGEFAQFDEWKDAEQLDW
MLFDFEMHQKMNMYVKALLKCYKRCKSLYELDHSPDGFEWIDVHNAEQSIFSFVRRGKKE
NDLLVVVCNFTSKVYHDYKVGVPLFAKYREIINSDAAKFGGWDNVNAKPVAASKEPFHGK
PYHIRMTVPPFGISILRPVKKRGERSVDGKEKVHRHVIGGRAR
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgttgtccctccgaccgatctggaaatttatttatttcacgaaggcagcttatat
aaaagttatgaattgtttggcgcgcatgtgataaaacaaaacgacgttgtcggaacccgg
ttttgcgtatgggctccgcatgcgcggcaagtgcggttagtcggcagttttaatgactgg
aacggaactaattttaatcttgtaaaagtaagtaatcaaggtgtatggacgatttttatt
ccggaaaacttggaagggcatttatataaatacgaaattaccactagcgatggaaatgtc
gtgttaaaagcagatccatacgcgtttcactccgaattgcgcccccgtactgcctccatc
gtctacgacataaaaggttatcaatggaatgaccaaacatggcgacggaagaaacagcga
aagcgaatatatgaccagcctttgttcatttatgagcttcacttcggttcgtggaaaaag
aaagaaaacggcaatttttatacatatcgggagatggcagatgagttacttccatatgtg
atggaacatggttttacccacattgaattgcttccgctcgttgaacatccgcttgaccgc
tcttggggatatcaaggaacaggttattattcagcaacaagccgctacgggacgccgcat
gatttgatgcattttattgatcgcttccatcaagcgggcattggcatcattttcgattgg
gttcccggccacttttgcaaagatgaacatggattatacatgtttgatggagcaccgaca
tatgaatatgacaacatacaagatcgggaaaatggcgaatggggcacggcgaattttgat
cttggcaagccggaagtccgcagctttttgatttccaatgcgttgttttggatggaatat
ttccacgtcgacggatttcgggtggatgcggtggccaatatgctgtattggccaaatagg
gaggcagcacagcaaaacccgcatgctgttcagtttttgcaaaaattaaatgagaccgta
tttgcgcatgacccgggcatattgatgattgccgaagattcgacggaatggccgctcgtc
actgctccaacgtatgccggagggctgggatttaactataaatggaacatggggtggatg
aacgatattttaacatatatggaaacggcgccggagaagcgaaaacatgtgcacaataaa
gtaaccttttcccttttgtacgcgtattcggaaaattttattttacctttttcccacgat
gaggtcgtgcatggaaaaaaatcgctgctaaataaaatgccggggacgtatgaggaaaag
tttgcacaattaaggctgctgtatgggtatttgctaacacatcccggcaagaaactattg
tttatgggcggcgaatttgcccagtttgatgaatggaaggatgcagagcagctggattgg
atgctttttgatttcgagatgcaccagaaaatgaatatgtacgtgaaagcattattgaaa
tgttataagcgctgcaaatctttgtatgagctagaccattctccagacgggtttgagtgg
attgatgttcataacgctgaacaaagtattttctcatttgtccgcagaggaaaaaaagaa
aacgatttgcttgttgtcgtgtgcaatttcaccagtaaagtgtatcacgattataaagtt
ggcgttccgctatttgccaaataccgggaaatcatcaacagcgatgcggccaaattcggg
gggtgggataatgtcaatgcaaagccggttgcggcgagcaaagaaccgtttcatggaaag
ccgtatcatattcgcatgacggttccgccgtttggcatttccattttaagaccagtgaaa
aaacggggggagagaagcgttgatggcaaagaaaaagtgcatcgccatgttattggcggg
agggcaaggtag

DBGET integrated database retrieval system