KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0747Help
Entry
GY4MC1_0747       CDS       T01348                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gmc00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
748031..748822
Genome map
AA seq 263 aa AA seqDB search
MWTWEANEGKGTVVIVHGAAEHHGRYKWLIEQWVKSGYHVVAGDLPGQGRTTRRKRGHIL
SFDEYINEVADWITEARQFHVPVFLLGHSMGGLIAIRTLQEKKLPVQGVILSSPCLGLVS
YPSKGLDMLSRVLNHIAPSLLIDSGLSVELATRNKEVHEAGKQDELYVTKVSVRWYRELI
KAMELASRRIQRFPDIPLLLMQGGDDKIVDKTAVKEWFDRLPISEKVYKEWNQLYHEIFN
EPEREDVFLYAKSFLDTQCRLYR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtggacatgggaggcaaatgaagggaaaggaacagttgtgattgtccacggagcagca
gagcatcatggacgttataaatggctgatcgaacagtgggtaaaaagcggctatcatgtg
gtcgcaggcgatttgcctggacaagggcggacaacgagaagaaaacgcggacatattctg
tcgttcgatgaatatattaatgaggtggctgattggatcacagaagcgagacaatttcat
gtaccagtgtttcttctcggacatagcatgggagggcttatcgccatccgcacgttgcaa
gaaaaaaagcttcctgtgcaaggggttattttgtcctccccatgtttagggcttgtgtcg
tatccgtcaaaagggcttgatatgttatcaagagtattgaatcatattgcaccatccctt
ttaatcgattcgggattgtctgtcgaattggcgacaagaaataaagaagtacatgaggcg
ggaaaacaagatgaactttatgtgacgaaagtatctgtccgttggtaccgcgaactaata
aaggcgatggaattggcttcccgccgtattcagcgatttcctgacattccattgctgctg
atgcagggcggagacgataaaattgtcgataaaacagccgtaaaagaatggttcgatcgt
ttgccgatatcggaaaaagtgtataaagaatggaaccaattgtaccatgaaatttttaat
gaaccggagcgagaagatgttttcttatacgcaaaatcgtttttagatacacaatgccga
ctgtatcgttag

DBGET integrated database retrieval system