KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0747Help
Entry
GY4MC1_0747       CDS       T01348                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GY4MC1_0747
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GY4MC1_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Thioesterase Abhydrolase_5 DUF1057 PGAP1 Esterase DUF1350 LIDHydrolase DUF676 Ser_hydrolase Peptidase_S15 Abhydrolase_2 Abhydrolase_8 LCAT Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: ADP73563
UniProt: A0A0F6BJG2
Position
748031..748822
Genome map
AA seq 263 aa AA seqDB search
MWTWEANEGKGTVVIVHGAAEHHGRYKWLIEQWVKSGYHVVAGDLPGQGRTTRRKRGHIL
SFDEYINEVADWITEARQFHVPVFLLGHSMGGLIAIRTLQEKKLPVQGVILSSPCLGLVS
YPSKGLDMLSRVLNHIAPSLLIDSGLSVELATRNKEVHEAGKQDELYVTKVSVRWYRELI
KAMELASRRIQRFPDIPLLLMQGGDDKIVDKTAVKEWFDRLPISEKVYKEWNQLYHEIFN
EPEREDVFLYAKSFLDTQCRLYR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtggacatgggaggcaaatgaagggaaaggaacagttgtgattgtccacggagcagca
gagcatcatggacgttataaatggctgatcgaacagtgggtaaaaagcggctatcatgtg
gtcgcaggcgatttgcctggacaagggcggacaacgagaagaaaacgcggacatattctg
tcgttcgatgaatatattaatgaggtggctgattggatcacagaagcgagacaatttcat
gtaccagtgtttcttctcggacatagcatgggagggcttatcgccatccgcacgttgcaa
gaaaaaaagcttcctgtgcaaggggttattttgtcctccccatgtttagggcttgtgtcg
tatccgtcaaaagggcttgatatgttatcaagagtattgaatcatattgcaccatccctt
ttaatcgattcgggattgtctgtcgaattggcgacaagaaataaagaagtacatgaggcg
ggaaaacaagatgaactttatgtgacgaaagtatctgtccgttggtaccgcgaactaata
aaggcgatggaattggcttcccgccgtattcagcgatttcctgacattccattgctgctg
atgcagggcggagacgataaaattgtcgataaaacagccgtaaaagaatggttcgatcgt
ttgccgatatcggaaaaagtgtataaagaatggaaccaattgtaccatgaaatttttaat
gaaccggagcgagaagatgttttcttatacgcaaaatcgtttttagatacacaatgccga
ctgtatcgttag

DBGET integrated database retrieval system