KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0762Help
Entry
GY4MC1_0762       CDS       T01348                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GY4MC1_0762
  Amino acid metabolism
   00300 Lysine biosynthesis
    GY4MC1_0762
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GY4MC1_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
761605..763017
Genome map
AA seq 470 aa AA seqDB search
MNINWLEEVLKRKEELIRDTQALLRIPSVLNEEDATEEAPFGRGVYEALRFLLQRGQEEG
FAVKNVDGFAGHLEIGQGDELIGVLCHVDVVPPGDGWSSDPFAAEIRDGKIYARGAIDDK
GPTMAAFYAMKIVKELGLPLSKRVRMIIGTDEESEWRCVEHYFQHEEMPTMGFAPDADFP
IIYAEKGIADIDLRMERTETSGDSEIRLQSFQAGRRYNMVPDFAEAVLLVHSDRQQEIAR
QYRQFLHDTNMNGNVVVNGNAVTLQLEGISAHAMEPENGKNAGLWLAKWLADLSQDAQAQ
SFIRFVTDHFFSDSRGKALGIAYSDEITGDLTVNVGILSYHEQSGGKIGINIRYPVTTDI
EQMKGKLERIAAQHGFVLERFGGLKPHYVDKHHVLVRTLQRVYEEQTGEPASLLSIGGGT
YARSLKAGVAFGPLFPGRPDVAHQKDEYIIIDDLLKATAIYAQAIYELAK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcaattggctggaagaagtattgaaacggaaagaagaactgattcgagatacg
caggcgttattgcgcattccgagcgtcctcaatgaagaagatgctacagaagaagcgccg
tttggcagaggagtgtacgaagcgctgcgttttttgctgcaacgcgggcaagaagaagga
tttgcggtaaaaaacgtcgatggatttgcgggacatcttgaaatcggacaaggggatgag
ttaatcggcgtattatgccatgttgatgttgttccgccgggagatggctggtcaagcgac
ccgtttgctgcggaaatccgcgacgggaaaatatacgcccgcggcgcaatcgatgataaa
ggaccgacaatggcggcgttttacgcgatgaaaattgtgaaagagcttggcttgccgctg
tcaaagcgggtgcgcatgattattggaaccgacgaagagagcgaatggcgctgtgtcgag
cattatttccaacatgaagaaatgccgacgatggggtttgctccagatgcagattttccg
attatttatgcggaaaaaggaattgccgatatcgatttgcgcatggaacggacggaaacg
agcggagacagcgagattcgcctgcagtcgtttcaggcgggccgccgttataatatggtt
cctgattttgctgaagcagtactgctcgtccattcagaccggcaacaagaaatcgcgcgg
cagtaccgccaatttcttcatgacacgaacatgaacggaaatgttgttgtgaacggaaat
gctgttacgcttcaattggaaggaatttctgcacatgcgatggagccggaaaacgggaaa
aatgctggtttatggctggcgaaatggctggcggatctttcacaagatgcgcaagcacaa
tcgtttatccgctttgtgacggaccatttcttttccgattctcgcggaaaagcgttagga
atcgcttatagcgatgagattaccggcgatttaacggtgaatgtcggaatattgtcatat
catgaacaatctggcggcaagatcggcattaacatacgctatccggtaacaacagatata
gaacaaatgaaagggaagctggagcgcatcgccgcacagcacggttttgtgctggaacgc
tttggcggtttgaagccgcattatgtcgataaacatcatgtgcttgtgcggacgcttcag
cgcgtgtacgaagaacagacgggagagcccgcttctttgctttccatcggcggcggcacg
tacgcccgttcgctgaaagcgggagtagcgtttgggccgctgtttccgggacggccggac
gtagcgcatcaaaaggatgaatatattattattgatgatctgctgaaagcaacagcgatt
tatgcccaagctatttacgaattagccaaatga

DBGET integrated database retrieval system