KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0787Help
Entry
GY4MC1_0787       CDS       T01348                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00010  Glycolysis / Gluconeogenesis
gmc00620  Pyruvate metabolism
gmc00640  Propanoate metabolism
gmc00680  Methane metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
gmc01130  Biosynthesis of antibiotics
gmc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_0787
   00620 Pyruvate metabolism
    GY4MC1_0787
   00640 Propanoate metabolism
    GY4MC1_0787
  Energy metabolism
   00680 Methane metabolism
    GY4MC1_0787
Enzymes [BR:gmc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GY4MC1_0787
Lipid biosynthesis proteins [BR:gmc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GY4MC1_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADP73603
UniProt: A0A0F6BJK2
Position
786140..787855
Genome map
AA seq 571 aa AA seqDB search
MKTEVLPVVQGDYNLKNYEEAYKNFDWKEVEKEFSWFETGRVNMAYEAIDRHVETFRKNK
VALYYRDASRNEKYTFKEMKELSNKVANVLKDVAEIEKGDRVFVFMPRSPELYFAVLGII
KTGAIAGPLFEAFMEGAVRDRLEDSGAKAIVTTPELLPRVPVNDLPALKYVFLVGDNIVE
EGPYIDLKKRMNEASKHFDIEWVDRQDGLILHYTSGSTGKPKGVLHVHNAMIQHYQTAKW
VLDLKEDDIYWCTADPGWVTGTSYGIFGPWLCGASNVIIGGRFSPDTWYQAIQDFGVTVW
YSAPTAFRMLMGAGDEIVKKYDLSSLRHILSVGEPLNPEVIRWGMKVFQRRIHDTWWMTE
TGAHLICNYPCMEIKPGSMGRPFPGVKAAIIDDQGNELPPYRMGNLAIKKGWPSMMKTIW
NNPQKYESYFIGDWYVSGDSAYMDEDGYFWFQGRVDDVINTSGERVGPFEVESKLVEHPA
VAEAGVIGKPDPVRGEIIKAFISLREGYEPSEELKEDIRQFVKKGLAAHAAPREIEFRDK
LPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagaagtgctaccggtcgtacaaggggattataacttaaaaaattatgaagag
gcatataaaaattttgactggaaggaagtagaaaaggaattttcctggtttgaaacagga
cgggtcaatatggcatatgaggcgattgaccgccatgtggaaacgttccgaaaaaataaa
gtggcgctttattaccgcgatgcgtcgagaaatgaaaagtatacgtttaaagaaatgaaa
gaattgtccaacaaagtggcaaacgtattgaaagacgtagcagagatcgaaaaaggggac
cgtgtatttgtttttatgccgcgttcgccggagctgtattttgcggtattaggaatcatt
aaaacaggcgcgattgccgggccgctgtttgaggcgtttatggaaggcgcggtgcgtgac
cgcttggaggatagcggggcgaaggcgattgtaacgactccggaacttttgccgcgagtg
ccagtaaacgatctgcctgcgctgaagtatgtttttcttgtcggggacaacattgttgaa
gaaggtccgtatattgatttaaagaaacgaatgaatgaagcaagcaagcatttcgatatt
gaatgggtcgatcgccaggacgggcttattttgcattatacatccggttccactggaaag
ccaaaaggggttttacatgttcacaatgcaatgattcagcactatcaaacggcaaaatgg
gtgcttgatttaaaagaagatgatatttattggtgcaccgctgacccgggatgggtgaca
ggaacgtcatatggcattttcggaccgtggttgtgcggagcgtccaacgtcattattggg
ggacgtttcagcccggatacgtggtatcaagcgattcaagattttggcgtgacggtgtgg
tatagtgcgccaacggcgtttcgcatgttgatgggcgccggagacgaaattgtgaaaaaa
tacgatttaagttcgctccgtcatattcttagcgttggagaaccgttgaatccagaagtg
attcgctggggaatgaaagtgttccagcgccgcattcacgacacatggtggatgacggaa
acaggtgctcatctcatttgtaactatccttgcatggaaatcaagccaggctcgatggga
aggccgtttcctggcgttaaagcagccatcattgatgatcaaggaaatgaactgccgcca
taccggatggggaacttggcgatcaaaaaaggctggccgtcgatgatgaaaacgatttgg
aacaatccgcaaaaatatgaatcgtatttcatcggcgattggtacgtttccggcgattcc
gcttatatggacgaagacggatatttctggttccagggccgtgttgatgacgttattaat
acgtccggagaacgcgtcggtccgtttgaagtcgagagcaagctggttgaacatccggcg
gtcgcggaagcaggcgtcatcggcaaaccggatccggtgcgcggggaaattatcaaagca
tttatttcgcttcgggaaggatatgaaccgtcagaggagctgaaagaagacatccgccag
tttgtcaaaaaaggattggcggcacatgcagcgccgcgggaaattgaattccgcgacaaa
cttccaaaaacgcgaagcggaaagatcatgcgccgcgtcctaaaagcgtgggaactcaat
ttgccaacgggggatttgtcgacaatggaagattaa

DBGET integrated database retrieval system