KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0787Help
Entry
GY4MC1_0787       CDS       T01348                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gmc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gmc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gmc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gmc00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:gmc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
786140..787855
Genome map
AA seq 571 aa AA seqDB search
MKTEVLPVVQGDYNLKNYEEAYKNFDWKEVEKEFSWFETGRVNMAYEAIDRHVETFRKNK
VALYYRDASRNEKYTFKEMKELSNKVANVLKDVAEIEKGDRVFVFMPRSPELYFAVLGII
KTGAIAGPLFEAFMEGAVRDRLEDSGAKAIVTTPELLPRVPVNDLPALKYVFLVGDNIVE
EGPYIDLKKRMNEASKHFDIEWVDRQDGLILHYTSGSTGKPKGVLHVHNAMIQHYQTAKW
VLDLKEDDIYWCTADPGWVTGTSYGIFGPWLCGASNVIIGGRFSPDTWYQAIQDFGVTVW
YSAPTAFRMLMGAGDEIVKKYDLSSLRHILSVGEPLNPEVIRWGMKVFQRRIHDTWWMTE
TGAHLICNYPCMEIKPGSMGRPFPGVKAAIIDDQGNELPPYRMGNLAIKKGWPSMMKTIW
NNPQKYESYFIGDWYVSGDSAYMDEDGYFWFQGRVDDVINTSGERVGPFEVESKLVEHPA
VAEAGVIGKPDPVRGEIIKAFISLREGYEPSEELKEDIRQFVKKGLAAHAAPREIEFRDK
LPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagaagtgctaccggtcgtacaaggggattataacttaaaaaattatgaagag
gcatataaaaattttgactggaaggaagtagaaaaggaattttcctggtttgaaacagga
cgggtcaatatggcatatgaggcgattgaccgccatgtggaaacgttccgaaaaaataaa
gtggcgctttattaccgcgatgcgtcgagaaatgaaaagtatacgtttaaagaaatgaaa
gaattgtccaacaaagtggcaaacgtattgaaagacgtagcagagatcgaaaaaggggac
cgtgtatttgtttttatgccgcgttcgccggagctgtattttgcggtattaggaatcatt
aaaacaggcgcgattgccgggccgctgtttgaggcgtttatggaaggcgcggtgcgtgac
cgcttggaggatagcggggcgaaggcgattgtaacgactccggaacttttgccgcgagtg
ccagtaaacgatctgcctgcgctgaagtatgtttttcttgtcggggacaacattgttgaa
gaaggtccgtatattgatttaaagaaacgaatgaatgaagcaagcaagcatttcgatatt
gaatgggtcgatcgccaggacgggcttattttgcattatacatccggttccactggaaag
ccaaaaggggttttacatgttcacaatgcaatgattcagcactatcaaacggcaaaatgg
gtgcttgatttaaaagaagatgatatttattggtgcaccgctgacccgggatgggtgaca
ggaacgtcatatggcattttcggaccgtggttgtgcggagcgtccaacgtcattattggg
ggacgtttcagcccggatacgtggtatcaagcgattcaagattttggcgtgacggtgtgg
tatagtgcgccaacggcgtttcgcatgttgatgggcgccggagacgaaattgtgaaaaaa
tacgatttaagttcgctccgtcatattcttagcgttggagaaccgttgaatccagaagtg
attcgctggggaatgaaagtgttccagcgccgcattcacgacacatggtggatgacggaa
acaggtgctcatctcatttgtaactatccttgcatggaaatcaagccaggctcgatggga
aggccgtttcctggcgttaaagcagccatcattgatgatcaaggaaatgaactgccgcca
taccggatggggaacttggcgatcaaaaaaggctggccgtcgatgatgaaaacgatttgg
aacaatccgcaaaaatatgaatcgtatttcatcggcgattggtacgtttccggcgattcc
gcttatatggacgaagacggatatttctggttccagggccgtgttgatgacgttattaat
acgtccggagaacgcgtcggtccgtttgaagtcgagagcaagctggttgaacatccggcg
gtcgcggaagcaggcgtcatcggcaaaccggatccggtgcgcggggaaattatcaaagca
tttatttcgcttcgggaaggatatgaaccgtcagaggagctgaaagaagacatccgccag
tttgtcaaaaaaggattggcggcacatgcagcgccgcgggaaattgaattccgcgacaaa
cttccaaaaacgcgaagcggaaagatcatgcgccgcgtcctaaaagcgtgggaactcaat
ttgccaacgggggatttgtcgacaatggaagattaa

DBGET integrated database retrieval system