KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0828Help
Entry
GY4MC1_0828       CDS       T01348                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:gmc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gmc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gmc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:gmc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gmc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gmc00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:gmc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
830189..831148
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGVYHGYAGLIAGKIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQLKGIEQLKKYGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDVIARLKRGHERGKKHSIIIVAEGVGSGVEFGKKIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQKMYLLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggtgtattaacaagtggcggagattcaccaggtatgaatgcggcgatc
cgcgccgtcgtccgcaaggcgatttaccatggagtagaagtatatggagtgtaccatggg
tatgctggtttaatcgctggaaaaataaaaaagttggaagtgggagatgtcggcgacatc
atccaccgcgggggaacgatactgtatacggcgcgctgtccggaatttaagacagaagag
gggcagttaaaagggattgaacaattgaaaaaatacggcatcgaaggattagtcgtgatt
ggtggggacggttcctaccaaggagcgaaaaagctaacagagcacggttttccttgtgtc
ggagtgccgggaacgattgacaatgacattcctggaacggattttacgattggatttgac
acggcgttaaatactgtaattgacgcgatcgacaaaattcgcgataccgctacatcacat
gaacggacatatgtgattgaagtaatgggacgccacgccggggatattgcgttatggtca
gggcttgccggaggggcggaaacgattttgattccagaagctgattacgatatggatgat
gttattgctcggttaaaacgcggacatgaacgcggcaaaaagcatagcattattatcgtt
gccgaaggtgtcggaagcggggtcgaatttggcaagaaaattcaagaagcgacagggttt
gaaacgcgcgttaccgtactggggcatgtgcagcgcggtggttctccaaccgcatttgac
cgcgtgttggccagccgtttaggtgctcgggcagtagaactattattagaaggcaaaggc
ggccgctgcgttggcatccaaaataatcagcttgtcgaccatgatattgcggaagcgttg
gccaacaaacatactattgatcaaaaaatgtatttgttgtcaaaagagctatccatttag

DBGET integrated database retrieval system