KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0828Help
Entry
GY4MC1_0828       CDS       T01348                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GY4MC1_0828
   01230 Biosynthesis of amino acids
    GY4MC1_0828
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GY4MC1_0828
   00030 Pentose phosphate pathway
    GY4MC1_0828
   00051 Fructose and mannose metabolism
    GY4MC1_0828
   00052 Galactose metabolism
    GY4MC1_0828
  Energy metabolism
   00680 Methane metabolism
    GY4MC1_0828
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GY4MC1_0828
Enzymes [BR:gmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GY4MC1_0828
Protein phosphatases and associated proteins [BR:gmc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GY4MC1_0828
Messenger RNA biogenesis [BR:gmc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GY4MC1_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
830189..831148
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGVYHGYAGLIAGKIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQLKGIEQLKKYGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDVIARLKRGHERGKKHSIIIVAEGVGSGVEFGKKIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQKMYLLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggtgtattaacaagtggcggagattcaccaggtatgaatgcggcgatc
cgcgccgtcgtccgcaaggcgatttaccatggagtagaagtatatggagtgtaccatggg
tatgctggtttaatcgctggaaaaataaaaaagttggaagtgggagatgtcggcgacatc
atccaccgcgggggaacgatactgtatacggcgcgctgtccggaatttaagacagaagag
gggcagttaaaagggattgaacaattgaaaaaatacggcatcgaaggattagtcgtgatt
ggtggggacggttcctaccaaggagcgaaaaagctaacagagcacggttttccttgtgtc
ggagtgccgggaacgattgacaatgacattcctggaacggattttacgattggatttgac
acggcgttaaatactgtaattgacgcgatcgacaaaattcgcgataccgctacatcacat
gaacggacatatgtgattgaagtaatgggacgccacgccggggatattgcgttatggtca
gggcttgccggaggggcggaaacgattttgattccagaagctgattacgatatggatgat
gttattgctcggttaaaacgcggacatgaacgcggcaaaaagcatagcattattatcgtt
gccgaaggtgtcggaagcggggtcgaatttggcaagaaaattcaagaagcgacagggttt
gaaacgcgcgttaccgtactggggcatgtgcagcgcggtggttctccaaccgcatttgac
cgcgtgttggccagccgtttaggtgctcgggcagtagaactattattagaaggcaaaggc
ggccgctgcgttggcatccaaaataatcagcttgtcgaccatgatattgcggaagcgttg
gccaacaaacatactattgatcaaaaaatgtatttgttgtcaaaagagctatccatttag

DBGET integrated database retrieval system