KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0853Help
Entry
GY4MC1_0853       CDS       T01348                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GY4MC1_0853
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GY4MC1_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
856715..857800
Genome map
AA seq 361 aa AA seqDB search
MAKLDATLTMLKELTDAKGVPGNEREAREVMKKYITPYADEVTTDGLGSLIAKKEGNSNG
PKIMVAGHLDEVGFMVTQIDEKGFIRFQTLGGWWSQVMLAQRVTILTRKGEITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDSIVPYFEFTVLNNEKMLLAKA
WDNRIGCAVAIDVLKQLKDAAHPNVVYGVGTVQEEVGLRGARTAAHFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLRDFVIDVAEELNIPYHFDAMPGGGT
DAGAIHLTASGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDAEKVKQITF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttgatgcaacattaacaatgctaaaagaattgacggacgctaaaggcgtt
ccgggcaatgaacgggaagcgcgcgaagtaatgaaaaagtacataactccttatgccgat
gaagtaacgacagacggtcttggcagtttaatcgcgaaaaaggaaggaaatagcaatggc
ccaaaaattatggttgccggccatttagacgaagttggctttatggtgacgcaaatcgat
gagaaaggatttatccgctttcaaacgttaggcggctggtggagccaagtcatgcttgca
cagcgcgtcaccattttaacgcgcaaaggagaaattaccggcgtcatcggttcgaaaccg
ccgcacattttgccgccggaagcgcgcaaaaagccagtcgaaatcaaagatatgttcatc
gacatcggcgcgacaagccgcgaggaagctatggaatggggcgtgcgcccgggcgactcg
atcgttccgtattttgagtttaccgtgttgaacaatgaaaaaatgctacttgcgaaagca
tgggataaccggatcggctgcgcggttgcgattgatgtgctcaagcaattaaaagatgct
gctcatccaaacgtcgtgtacggtgtcggcacggtgcaggaagaagtcggtttgcgcggg
gcgagaacggcagcgcatttcattcagccggatatcgcttttgctgtggatgtcggcatt
gctggcgatacgccaggcgtttccgaaaaagaagcgatgggcaagcttggcgccggaccg
cacattgtgctgtacgacgcaacaatggtgtcccatcgcggtttgcgcgattttgtcatt
gatgtcgctgaagaactcaacattccttaccattttgacgcgatgccgggcggcggcact
gacgctggcgcgatccatttaacggcaagcggcgtgccgtcattgacgatcgcgattcca
acacgctacatccattcccatgcggcgattttgcaccgtgacgattacgaaaatacggta
aaattgcttgtcgaagtcatcaagcgtttagacgcggaaaaagtaaaacaaattaccttt
gaataa

DBGET integrated database retrieval system