KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0853Help
Entry
GY4MC1_0853       CDS       T01348                                 

Definition
(GenBank) Cellulase
Organism
gmc  Geobacillus sp. Y4.1MC1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
856715..857800
Genome map
AA seq 361 aa AA seqDB search
MAKLDATLTMLKELTDAKGVPGNEREAREVMKKYITPYADEVTTDGLGSLIAKKEGNSNG
PKIMVAGHLDEVGFMVTQIDEKGFIRFQTLGGWWSQVMLAQRVTILTRKGEITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDSIVPYFEFTVLNNEKMLLAKA
WDNRIGCAVAIDVLKQLKDAAHPNVVYGVGTVQEEVGLRGARTAAHFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLRDFVIDVAEELNIPYHFDAMPGGGT
DAGAIHLTASGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDAEKVKQITF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttgatgcaacattaacaatgctaaaagaattgacggacgctaaaggcgtt
ccgggcaatgaacgggaagcgcgcgaagtaatgaaaaagtacataactccttatgccgat
gaagtaacgacagacggtcttggcagtttaatcgcgaaaaaggaaggaaatagcaatggc
ccaaaaattatggttgccggccatttagacgaagttggctttatggtgacgcaaatcgat
gagaaaggatttatccgctttcaaacgttaggcggctggtggagccaagtcatgcttgca
cagcgcgtcaccattttaacgcgcaaaggagaaattaccggcgtcatcggttcgaaaccg
ccgcacattttgccgccggaagcgcgcaaaaagccagtcgaaatcaaagatatgttcatc
gacatcggcgcgacaagccgcgaggaagctatggaatggggcgtgcgcccgggcgactcg
atcgttccgtattttgagtttaccgtgttgaacaatgaaaaaatgctacttgcgaaagca
tgggataaccggatcggctgcgcggttgcgattgatgtgctcaagcaattaaaagatgct
gctcatccaaacgtcgtgtacggtgtcggcacggtgcaggaagaagtcggtttgcgcggg
gcgagaacggcagcgcatttcattcagccggatatcgcttttgctgtggatgtcggcatt
gctggcgatacgccaggcgtttccgaaaaagaagcgatgggcaagcttggcgccggaccg
cacattgtgctgtacgacgcaacaatggtgtcccatcgcggtttgcgcgattttgtcatt
gatgtcgctgaagaactcaacattccttaccattttgacgcgatgccgggcggcggcact
gacgctggcgcgatccatttaacggcaagcggcgtgccgtcattgacgatcgcgattcca
acacgctacatccattcccatgcggcgattttgcaccgtgacgattacgaaaatacggta
aaattgcttgtcgaagtcatcaagcgtttagacgcggaaaaagtaaaacaaattaccttt
gaataa

DBGET integrated database retrieval system