KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0879Help
Entry
GY4MC1_0879       CDS       T01348                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gmc01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gmc00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
883080..883853
Genome map
AA seq 257 aa AA seqDB search
MEFFRVHKEEFVADVAFSRPPANALSSAVLKELSSLLDELEADENVRVVLLHGEGRFFSA
GADIKEFTSIKSSEEAVKLSKTGQQVLERIERFTKPVIAAVHGAALGGGLELAMSCHVRI
VSENAKLGLPELQLGIIPGFAGTQRLPRYVGFSKAAEMMWTSEPITGTEAVQWGLASKAV
PEEQLLEEAKKLAKKIAQKSPISIRATLQLLNAFKEKSFQEAVREEAELFGSVFTTEDAK
EGVQAFIEKRPPSFQGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaattttttcgcgttcataaagaagagtttgttgcggacgtggcgttttcccgtcct
ccggcaaacgctctttcatctgcagttttgaaagagctttcatcattgctggatgagctg
gaggcggatgaaaatgtccgcgtcgtgcttcttcatggtgaggggagatttttctcggca
ggtgccgatattaaagagtttacatccataaaatccagcgaagaagccgtaaagctgtca
aaaactggccagcaagtattggagcgcatcgagaggtttacaaagcctgtgattgcggcg
gtccatggcgcggcattaggcggcggattggagctggcgatgagctgccacgttcgcatt
gtttccgaaaacgcaaaactcggattgccggagctgcagcttggcattatacctggcttt
gccggaacccagcggcttccccgctatgtcggtttcagcaaagcggccgagatgatgtgg
acgagcgaaccgattactggaacggaagcggtgcaatggggattggcaagcaaggcggtg
ccggaagaacaactgttggaggaagcaaaaaaactggcgaaaaaaatcgcgcaaaaaagc
ccgatttcgattcgcgcgacattgcagcttttaaacgcctttaaagaaaaatcgttccaa
gaagcggtgcgcgaggaagcggaattgtttggaagtgtgtttacgacagaagacgcgaaa
gaaggagtgcaggcatttattgaaaaacgcccgccatcctttcaggggaaatga

DBGET integrated database retrieval system