KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0926Help
Entry
GY4MC1_0926       CDS       T01348                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
gmc00860  Porphyrin and chlorophyll metabolism
gmc01100  Metabolic pathways
gmc01110  Biosynthesis of secondary metabolites
gmc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GY4MC1_0926
Enzymes [BR:gmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GY4MC1_0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADP73740
UniProt: A0A0F6BJY9
Position
933964..934764
Genome map
AA seq 266 aa AA seqDB search
MASGPLSGKTVLVTREKEQAKAFSEKLREAGAIPVEIPLIAISPSSHHEEIERCARQLSD
YDWLVFTSANGVRFFFPFVKQKTLLPKVVVVGKKTAAALKAYGVSPAVVPDEFVAEGVIE
ALKPLVKPRDRVLLVKGNLARTVLRDALIDMGADVTDLIVYKTSMNEAGKERLLCLLREK
KLDVITFTSSSTVQSFLRMMERGDIASLLAGCAVACIGPITKKTAEKAGLSVHICPSEYT
IDAMIKEMEAYFARCDGGKINGNITI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcggtccgttgtcgggaaaaacggtgcttgtgacaagggaaaaagaacaggca
aaagcgttttccgaaaagctgcgtgaagccggggcgattccggtagaaattccgcttatt
gcgatttctccttcttcccatcatgaagaaatcgagcggtgtgcacgccagctttccgat
tatgattggctcgttttcacaagcgcgaacggcgtgcggtttttcttcccgtttgtcaaa
cagaaaacgctgcttccaaaagtggtggtcgtcggcaaaaaaacggcagcggcgttaaaa
gcatatggcgtttctcctgccgtcgtccctgacgaatttgtggccgaaggtgtcatcgag
gcgctaaaaccgcttgtgaagccgcgcgatcgcgtgcttttagtcaaagggaatttggca
aggacggtattgcgggatgcgctaatcgacatgggggcagacgtaacggaccttattgtg
tataaaacgtcgatgaacgaagcaggaaaagaacgattgctatgcctgctccgggaaaaa
aaactcgatgtcattacgtttacaagctcttcaactgtacaaagctttctgcggatgatg
gaaagaggagatatcgcttcattgcttgccggctgtgcggttgcctgcatcggcccgatt
acgaagaagacggcggaaaaagcggggctttccgtgcatatttgtccaagcgagtatacg
attgatgctatgataaaagagatggaggcatatttcgcaagatgtgatggagggaaaata
aatggaaacattacgatttga

DBGET integrated database retrieval system