KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_0927Help
Entry
GY4MC1_0927       CDS       T01348                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GY4MC1_0927
Enzymes [BR:gmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GY4MC1_0927
Exosome [BR:gmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GY4MC1_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
934745..935722
Genome map
AA seq 325 aa AA seqDB search
METLRFDRHRRLRQTANLRAMVRETHLHVDDLIYPIFVAEGNGVKREVPSMPGIYQFSLD
RLNEEMDEVVGLGIKSVIVFGVPAEKDEVGSQAYCEHGIVQRAIHQIKENYPDIVVIADT
CLCEYTSHGHCGVVENEQVLNDPSLELLAKTAVSQAQAGADIIAPSNMMDGFVAAIRRGL
DEAGFTNVPIMSYAIKYASAFYGPFRDAADSAPQFGDRKTYQMDPANRREAFREAESDVR
EGADFLMVKPALSYLDIIRDIKNHFHLPVVTYNVSGEYSMVKAAAQNGWINEKDIVMEML
ISMKRAGADLIITYFAKDVARWLNE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaaacattacgatttgaccgccatcgccgtttgcggcagaccgcgaatttgcgggcg
atggtgagagaaacacatcttcatgtcgacgatcttatttatccgatttttgtcgccgaa
ggaaacggggtaaaaagagaagtaccgtcaatgcccggaatataccaattttcgcttgac
cgtttaaatgaagaaatggacgaagtcgtcgggctcggcattaaatcggtgatcgttttt
ggcgtgccggcggaaaaagatgaagtcggctcacaggcatattgcgaacatggcatcgtc
cagcgggcgatccaccaaataaaagaaaattatccggatatcgtcgtcatcgctgatacc
tgtttgtgtgaatacacgagccatggacattgcggcgttgtcgaaaatgaacaagtatta
aacgatccatcgctggaattgctggcgaaaaccgctgtcagccaagcgcaagcgggagcg
gatatcatcgccccttccaatatgatggacggctttgttgcggcgatccgccgcgggctc
gatgaagccggctttacgaacgtgccgattatgtcgtacgcgataaaatatgcgtccgca
ttttacggtccgttccgtgacgctgcggatagcgcgccgcaatttggcgaccggaaaacc
taccaaatggatccggcaaaccgccgcgaagcgttccgggaagcggaatcggatgtgcgc
gaaggcgctgactttttaatggtgaaaccggcgctttcctatttagatattatccgcgac
attaaaaaccatttccaccttcctgtcgttacatataacgtgagcggggaatattcgatg
gtcaaagcggcggcgcaaaacggctggattaacgaaaaagacattgtcatggagatgctg
ataagcatgaaacgggccggcgccgatttaatcatcacttattttgcgaaagatgtggcg
cgctggttaaacgaatag

DBGET integrated database retrieval system