KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1006Help
Entry
GY4MC1_1006       CDS       T01348                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gmc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GY4MC1_1006
Enzymes [BR:gmc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GY4MC1_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1016692..1019046
Genome map
AA seq 784 aa AA seqDB search
MQQPESFVFEGTSFIKGSYISTIFHNEANLYSVVRVRVEETNEAYDEQEVVVTGYFPKMN
EHDTYIFYGKFHDHPKFGRQYVVDHFRKQFPNTKDGIIHYLSSDLFKGIGKKTAKAIVEA
LGENAISKILADPSVLDDVPKLSKQRAKELYDTLRAHEGLEQTMIALSQFGFGPQLSMKI
YQVYQDETLSVIQQNPYQLVEDVEGIGFGRADELGYRLGISGSHPARIRAACLFVIERDC
LQEGHVYVTERQLVTNIKQLLEAKRKETVSEEAIEQMLLMLSEEGKLIKEDEKFYIPSLY
FAEKGIVTNVKRLLQQTEAVMTFPESEFLLALGRLEERLSVQYAPTQKEAIRQALSSPLF
ILTGGPGTGKTTVIKGIVEIFADLHGFSLDPKDYTKDDPFPILLAAPTGRAAKRMSEATG
LPAVTIHRLLGWNGAEGFTHDEDEPISGKLLIVDEMSMVDTWLANQLFKSIPDGMQVILV
GDEDQLPSVGPGQVLKDLLQAGVIPTVRLTEVYRQAEGSSIIELAHQMKNGGLPPDLTAP
KADRSFIRCQTSQVAEVVRQIADNARRKGFAVKDIQVLAPMYRGPAGIDRLNQVLQDLFN
PKSEKKRELSVGDVIYRVGDKVLQLVNQPDDNVFNGDIGEIVAIFYAKENTEKQDLVVVS
FDGIEVTYSRQDLSQITHAYCCSIHKSQGSEFPIVILPVVKSYYRMLKRNLLYTAVTRSK
QFLIICGEEEAFKLGVARSDDSSRQTTLTEKLQKILVPAVEGELPMEDANIGMENVSPYD
FMDE
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcaaccggaatcatttgttttcgagggaacttcgtttataaaaggttcatatatt
tccaccatttttcataatgaagcgaatttgtattccgtcgttcgcgtccgggtcgaagaa
acgaacgaagcgtacgatgaacaagaagttgtggtgaccggatatttccctaaaatgaac
gagcatgacacgtatattttttacgggaaatttcatgaccatccaaagttcggccggcaa
tatgttgtcgaccatttccgcaaacaattccctaacacgaaagacggcatcattcactat
ttatccagcgatttatttaaaggaatcgggaaaaaaacggcaaaagcgatcgtcgaagcg
cttggcgaaaatgccatttccaaaattttagcggatccaagcgtgttggatgatgttcca
aaattgtcaaagcaaagggcaaaagagctgtatgatacgctgcgtgcccatgaagggctg
gaacagacgatgatcgcgctttcccagtttggttttggcccgcaattgtcgatgaaaatt
tatcaagtataccaagatgaaacactctccgttattcagcaaaacccctaccagcttgtc
gaagatgtcgaaggaatcggctttggccgcgccgacgaattaggctaccggcttggcatt
tccggcagccatcctgcgcgcattcgcgcggcgtgtttgtttgtgatagaacgggattgc
cttcaagaagggcatgtgtatgtgacagaaaggcagcttgtcacaaacattaaacagctt
ttggaagcaaaacgaaaagaaacagtcagtgaagaagcgatcgagcaaatgttgttaatg
ctttctgaagaaggaaagctaatcaaggaagatgaaaaattttatattccgtcgctttat
tttgctgaaaaaggaattgtgacaaatgtgaagcgccttttacagcaaacggaagcagtg
atgacgtttccggaatcggaatttttgctggcgctcggaaggcttgaggagcgtttatcc
gttcaatatgctcccacgcaaaaagaagcgattcgacaagcgctttcttccccgctgttt
attttgaccggaggccccggcacaggaaaaacgacagtcattaaagggattgtggaaatt
ttcgctgatttgcacggtttttccctcgatccgaaagattacacgaaagatgatccattt
ccgattttgctcgccgcgccgacgggaagggcggcaaaaagaatgagcgaagcgacgggg
ttgcctgcggtgacgattcaccgtttgcttggatggaatggggcggaaggttttacccat
gacgaggacgagccgattagcggcaaacttttaatcgttgatgaaatgtcgatggtcgat
acgtggctggccaatcagctgtttaagtcgattccggacggcatgcaagtgatccttgtc
ggggatgaagatcagctgccatctgtcggaccgggacaagtgttaaaggatttattgcaa
gcgggtgtcatcccgaccgttcggctaaccgaagtgtaccggcaagcggagggctcatcg
attatcgaattggcgcaccaaatgaaaaacgggggccttcctccggacttaactgctcca
aaggcagaccgttcattcattcgctgccagacttcacaagttgctgaagttgtccggcaa
attgccgacaacgcgcgcagaaaaggcttcgcagtgaaagacattcaagtgcttgccccg
atgtatcgcggccctgccgggatcgaccgcctcaatcaagtgctgcaagatttgtttaat
ccgaaatctgagaaaaagcgggaactttcggttggcgatgtcatatatcgggttggtgat
aaggtgctgcagcttgtcaaccaacctgatgacaatgtgtttaatggggacattggggaa
attgtcgcgattttttacgcgaaagaaaatacggagaagcaagatttagttgtcgtttct
tttgacggcatcgaggtgacatattcgcggcaagatttgtcgcaaattacgcatgcatat
tgctgttccattcataaatcgcaaggaagcgaatttccaattgtcattttgccggttgtg
aaaagctattatcgcatgttaaagcggaatttattatatacggccgtgacaagaagcaaa
caatttttaattatatgcggcgaagaagaggcgtttaaattaggggttgcccgcagtgat
gatagctcccggcaaacaacgctgacggaaaaattgcaaaaaattcttgtccctgctgtt
gaaggggagctgccgatggaagacgcgaacatcggaatggaaaacgtttcaccgtatgac
tttatggatgagtag

DBGET integrated database retrieval system