KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1122Help
Entry
GY4MC1_1122       CDS       T01348                                 

Definition
glucokinase, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:gmc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gmc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gmc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gmc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gmc00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:gmc00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1119187..1120152
Genome map
AA seq 321 aa AA seqDB search
MTDMTEKWLVGVDLGGTTTKMAFLTEYGDIVHKWEIDTDLSNKGENIVRHIAQSLEDTLH
RLGESKERLLAIGIGAPGPVQRETGMLYEAVNLGWKNYPLKERLERETSLPVAVDNDANI
AALGEMWKGAGNGARDLICVTLGTGVGGGVIANGQIVHGVNGAGGEIGHMTLVAKGGAPC
NCGKTGCLETIASATGIVRIAKEKLSQWDKPTLLRGETITAKAVFDAAKANDELALAIVD
EVMFYLGLALANAANVSNPEKIVIGGGVSKAGNILVERVGAYFRRFAFPRVAEGATIALA
TLGNDAGVIGGAWLAKTSLHV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacggacatgacggaaaaatggcttgttggcgttgatttaggcggaacaacgacgaaa
atggcatttttaacagaatatggtgatattgtacataaatgggagattgatacagatctt
tccaacaagggggaaaacatcgtcagacatattgcgcaatcgctagaagacacgttgcat
cgcttaggagaaagcaaggaacggcttttagcgatcgggattggcgcgccaggcccggtg
caaagggaaacagggatgctttatgaagcagtgaacttaggatggaaaaattatcctctc
aaagaacggttagagcgggaaacctctcttcctgtagcggtagataatgacgcgaatatt
gctgcgcttggagaaatgtggaaaggagccggtaacggcgcgcgcgatcttatttgcgtg
acacttggcaccggcgtcggcggcggagtgatcgccaatggtcaaattgtgcatggcgtc
aacggcgctggcggagaaatcggccacatgacattggttgccaaaggcggcgcgccgtgt
aattgcggcaaaaccggatgtttagaaacgattgcttctgcgacgggaattgtgcgaatt
gcgaaagaaaaattgtcacagtgggacaagccgactttgcttcgcggtgaaactatcacc
gcgaaagcggtgttcgatgcggcgaaagcgaatgacgaactggcgctcgcaattgtggat
gaagtgatgttttacctaggattagcgttggcgaatgcggcgaacgtgtccaatccggaa
aaaatcgtaattggcggcggcgtgtcaaaagcaggaaatatattggtggaacgcgtcggt
gcttatttccgccgctttgcgtttccgcgtgtcgcagaaggggcgacgattgctctggca
acacttggaaacgatgcgggagtaatcggcggcgcatggctggcgaaaacgtcgctccac
gtttga

DBGET integrated database retrieval system