KEGG   Geobacillus sp. Y4.1MC1: GY4MC1_1330Help
Entry
GY4MC1_1330       CDS       T01348                                 

Definition
RNA binding S1 domain-containing protein
Orthology
K02945  
small subunit ribosomal protein S1
Organism
gmc  Geobacillus sp. Y4.1MC1
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:gmc03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1303484..1304647
Genome map
AA seq 387 aa AA seqDB search
MTEDMNLQVNVYKVGDIVRGKVAKLEDKQVLVDIEGSKQSGIIPISELSSLHIDKTSDAV
SVGDEVTAKVKKVEEGENEEDGLLILSKKAVDAERAWEELERRFASGETFEVIVKDIVKG
GLVADVGVRGFIPASLVEPHYVEDFSDYKGKPLAVKVVELDREKNRVILSHRAVVEEEQE
RQRKEALSRLETGQVLEGIVRRITDFGVFVDVGGFDGLVHISQLSHTRVAHPSDVVQEGE
TVKVKVLSVDEENGRVSLSIKEALPSPWEGIAEKIAPGDIVTGKVKRLVPFGAFVEIFPG
IEGLVHISQISTKRIGTPHEVLKEGEEVKAKVLDVSEAERRISLSIRDLIEEETASEEDY
SQYAKPANEVKGFQIGEVIGEQLKKLK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggatatgaatttacaagtgaacgtatacaaggtaggtgatatcgttcgcgga
aaagtggcaaaattagaagataagcaagtgcttgttgatattgaaggaagcaaacaaagc
gggattatcccaattagcgaattgtcgagtttgcatattgacaaaacaagtgatgccgtt
tctgtcggcgatgaagtgacagcgaaagtaaaaaaagtggaagaaggcgaaaatgaagaa
gacgggttgctgattttatcaaagaaagcagtggacgctgaacgcgcttgggaggaattg
gagcgaagatttgctagcggggaaacgtttgaagtcatcgtgaaggacatcgtcaaaggc
gggcttgttgctgatgttggagtgcgcggatttatccctgcctctctcgtagagccgcac
tatgtcgaggatttttccgactacaaaggcaagccgcttgcggtcaaagtggtagagctt
gatcgtgaaaaaaaccgcgtcattttgtcacatcgtgctgtcgtggaagaagagcaagag
cgccagcgtaaggaggcgttaagccgcttagagacagggcaagtgctcgaaggaatcgtg
cgccgcatcaccgattttggcgtatttgtcgatgttggcggctttgatggtctcgtacat
atttcccagctttcccatacgcgcgttgcacatccatccgatgtcgtgcaagaaggggaa
acggtgaaagtaaaagtgctttccgttgacgaggagaacggtcgtgtctccctctctata
aaagaagcgttgccaagcccttgggaaggaattgccgaaaaaatcgcccctggtgatatt
gttaccggcaaagtgaagcggcttgtgccgttcggtgcgtttgtggaaattttcccaggg
atcgaagggcttgtccacatttcgcaaatttcaacgaaacgcatcggcactccgcatgaa
gtgttgaaagaaggggaagaagtaaaagcgaaagtgcttgatgtcagcgaagcggaacgc
cgtatttccctaagcatacgcgatttaattgaagaagaaaccgcttcggaagaagactat
agccaatacgcaaagccggcaaacgaggtaaaaggcttccaaattggcgaagtaattggg
gaacagctgaaaaaattaaaataa

DBGET integrated database retrieval system